wyndhamchildandfamilydirectory.com.au
UNIWAREMS-AS-AP Uniware Managed Services Pty Ltd, AU


Not observed on urlscan.io


General Info Open in Search

Geo Australia (AU) —
AS AS45601 - UNIWAREMS-AS-AP Uniware Managed Services Pty Ltd, AU
Note: An IP might be announced by multiple ASs. This is not shown.
Route 203.176.120.0/23 (Route of ASN)
IPv4 203.176.121.240 

Live Screenshot Hover to expand

Attention: This is a live snapshot of this website, we do not host or control it!

No direct hits
Nothing is hosted on this domain

No incoming hits
Nothing talked to this domain

Disclaimer

The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.

Recently observed hostnames on 'wyndhamchildandfamilydirectory.com.au'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.

cpcalendars.wyndhamchildandfamilydirectory.com.au | 2020-08-07 cpcontacts.wyndhamchildandfamilydirectory.com.au | 2020-08-07 wcfd.wyndhamchildandfamilydirectory.com.au | 2019-08-05 www.wcfd.wyndhamchildandfamilydirectory.com.au | 2019-08-05 autodiscover.wyndhamchildandfamilydirectory.com.au | 2019-08-02 cpanel.wyndhamchildandfamilydirectory.com.au | 2019-08-02 mail.wyndhamchildandfamilydirectory.com.au | 2019-08-02 webdisk.wyndhamchildandfamilydirectory.com.au | 2019-08-02 webmail.wyndhamchildandfamilydirectory.com.au | 2019-08-02 www.wyndhamchildandfamilydirectory.com.au | 2019-08-02 wyndhamchildandfamilydirectory.com.au | 2019-08-02

Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.

DNS recordsRetrieved via DNS ANY query

A 203.176.121.240 (TTL: 14400)
MX wyndhamchildandfamilydirectory.com.au
NS ozisp-cp2.ozisp.com.au
NS ozisp-cpdns1.ozisp.com.au
NS ozisp-cpdns2.ozisp.com.au
NS ozisp-cpdns3.ozisp.com.au
TXT v=spf1 ip4:203.176.121.200 +a +mx +ip4:203.176.121.240 +ip4:203.176.120.194 ~all
SOA ozisp-cpdns1.ozisp.com.au
hostmaster: whm.ozisp.com.au / serial: 2024111701 / refresh: 3600 / retry: 1800 / expire: 1209600 / minttl: 86400 /

WHOIS for wyndhamchildandfamilydirectory.com.au

Domain Name: wyndhamchildandfamilydirectory.com.au
Registry Domain ID: c9fb17efd7b7443b8ace8999e4960ba5-AU
Registrar WHOIS Server: whois.auda.org.au
Registrar URL: https://elb.www.netregistry.com.au/contact-us/
Last Modified: 2024-04-24T12:44:00Z
Registrar Name: Melbourne IT
Registrar Abuse Contact Email: abuse@webcentral.com.au
Registrar Abuse Contact Phone: +61.279080901
Reseller Name: 
Status: serverRenewProhibited https://identitydigital.au/get-au/whois-status-codes#serverRenewProhibited
Status Reason: Not Currently Eligible For Renewal
Registrant Contact ID: 058d71ae2f6c4dc19279d221727fc348-AU
Registrant Contact Name: IT Infrastructure
Tech Contact ID: 0bd70f8a71144858bbfd2d023279afac-AU
Tech Contact Name: Karen Thomson
Name Server: ozisp-cpdns1.ozisp.com.au
Name Server IP: 52.65.219.29
Name Server: ozisp-cpdns2.ozisp.com.au
Name Server IP: 203.176.121.5
DNSSEC: unsigned
Registrant: WYNDHAM CITY COUNCIL
Eligibility Type: Company
Eligibility ID: ABN 38393903860
>>> Last update of WHOIS database: 2025-01-08T02:04:24Z <<<

Identity Digital Australia Pty Ltd, for itself and on behalf of .au Domain Administration Limited (auDA), makes the WHOIS registration data directory service (WHOIS Service) available solely for the purposes of:

(a) querying the availability of a domain name licence;

(b) identifying the holder of a domain name licence; and/or

(c) contacting the holder of a domain name licence in relation to that domain name and its use.

The WHOIS Service must not be used for any other purpose (even if that purpose is lawful), including:

(a) aggregating, collecting or compiling information from the WHOIS database, whether for personal or commercial purposes;

(b) enabling the sending of unsolicited electronic communications; and / or

(c) enabling high volume, automated, electronic processes that send queries or data to the systems of Afilias, any registrar, any domain name licence holder, or auDA.

The WHOIS Service is provided for information purposes only. By using the WHOIS Service, you agree to be bound by these terms and conditions. The WHOIS Service is operated in
accordance with the auDA WHOIS Policy (available at https://www.auda.org.au/policy/2014-07-whois-policy).