www.pyreneesmediterraneeattractivite.fr
OVH OVH SAS, FR


Not observed on urlscan.io


General Info Open in Search

Geo France (FR) —
Domain pyreneesmediterraneeattractivite.fr (The registered domain)
AS AS16276 - OVH OVH SAS, FR
Note: An IP might be announced by multiple ASs. This is not shown.
Route 51.77.0.0/16 (Route of ASN)
IPv4 51.77.184.224 

Live Screenshot Hover to expand

Attention: This is a live snapshot of this website, we do not host or control it!

No direct hits
Nothing is hosted on this domain

No incoming hits
Nothing talked to this domain

Disclaimer

The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.

Recently observed hostnames on 'www.pyreneesmediterraneeattractivite.fr'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.

www.pyreneesmediterraneeattractivite.fr | 2023-03-24

Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.

DNS recordsRetrieved via DNS ANY query

A 51.77.184.224 (TTL: 3600)

WHOIS for www.pyreneesmediterraneeattractivite.fr


domain:                        pyreneesmediterraneeattractivite.fr
status:                        ACTIVE
eppstatus:                     active
hold:                          NO
holder-c:                      CTC1983469-FRNIC
admin-c:                       ADDE157-FRNIC
tech-c:                        ADDE157-FRNIC
registrar:                     GANDI
Expiry Date:                   2025-10-31T15:40:26.857889Z
created:                       2022-10-31T15:40:26.873255Z
last-update:                   2024-10-29T14:46:29.998091Z
source:                        FRNIC

nserver:                       a.dns.gandi.net
nserver:                       b.dns.gandi.net
nserver:                       c.dns.gandi.net
source:                        FRNIC

registrar:                     GANDI
address:                       63-65 boulevard Massena
address:                       75013 PARIS
country:                       FR
phone:                         +33.170377661
fax-no:                        +33.143731851
e-mail:                        support@support.gandi.net
website:                       https://www.gandi.net/fr/tlds/fr/
anonymous:                     No
registered:                    2004-03-08T00:00:00Z
source:                        FRNIC

nic-hdl:                       ADDE157-FRNIC
type:                          ORGANIZATION
contact:                       Agence de Developpement Economique Perpignan Mediterranee ID
address:                       Agence de Developpement Economique Perpignan Mediterranee ID
address:                       35 boulevard St Assiscle
address:                       66000 Perpignan
country:                       FR
phone:                         +33.468086262
e-mail:                        agence.dev.eco@perpignan-mediterranee.org
registrar:                     GANDI
changed:                       2023-02-03T10:29:36.326382Z
anonymous:                     NO
obsoleted:                     NO
eppstatus:                     associated
eppstatus:                     active
eligstatus:                    not identified
reachstatus:                   not identified
source:                        FRNIC

nic-hdl:                       CTC1983469-FRNIC
type:                          ORGANIZATION
contact:                       SPL PERPIGNAN MEDITERRANEE
address:                       SPL PERPIGNAN MEDITERRANEE
address:                       35 boulevard Saint-Assiscle
address:                       66000 Perpignan
country:                       FR
phone:                         +33.468517025
e-mail:                        c.morin@splpm.org
registrar:                     GANDI
anonymous:                     NO
obsoleted:                     NO
eppstatus:                     associated
eppstatus:                     active
eligstatus:                    not identified
reachstatus:                   not identified
source:                        FRNIC

>>> Last update of WHOIS database: 2025-01-18T10:17:54.399578Z <<<