www.ontwerpenaanklimaatenwater.nl
SSO-ICT SSC-ICT Haaglanden, NL


Seen 1 times between January 19th, 2021 and January 19th, 2021.


General Info Open in Search

Geo Amsterdam, Netherlands (NL) —
Domain ontwerpenaanklimaatenwater.nl (The registered domain)
AS AS48037 - SSO-ICT SSC-ICT Haaglanden, NL
Note: An IP might be announced by multiple ASs. This is not shown.
Route 147.181.64.0/18 (Route of ASN)
PTR www.minvrom.nl(PTR record of primary IP)
IPv4 147.181.98.150 
IPv6 2a04:9a03:1011:1001::8

Live Screenshot Hover to expand

Attention: This is a live snapshot of this website, we do not host or control it!

No direct hits
Nothing is hosted on this domain

Incoming hits
Summary of pages that talked to this domain

ASNs AS3265 | 1x

IPs 82.94.240.135 | 1x

Domains ontwerpenaanklimaatenwater.archiefweb.eu | 1x

Countries NL | 1x

Recent scans (1 total) Show all

URL Age
ontwerpenaanklimaatenwater.archiefweb.eu 4 years

Disclaimer

The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.

Recently observed hostnames on 'www.ontwerpenaanklimaatenwater.nl'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.

www.ontwerpenaanklimaatenwater.nl | 2017-12-11

Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.

Related screenshots
Screenshots of pages that talked to this domain

DNS recordsRetrieved via DNS ANY query

CNAME ontwerpenaanklimaatenwater.nl

WHOIS for www.ontwerpenaanklimaatenwater.nl

Error: ratelimit exceeded