www.franklinpharmacyandhealthcare.com
AMAZON-AES, US


Not observed on urlscan.io


General Info Open in Search

Geo Ashburn, Virginia, United States (US) —
Created August 15th, 2003
Domain franklinpharmacyandhealthcare.com (The registered domain)
AS AS14618 - AMAZON-AES, US
Note: An IP might be announced by multiple ASs. This is not shown.
Route 54.224.0.0/14 (Route of ASN)
PTR ec2-54-226-104-55.compute-1.amazonaws.com(PTR record of primary IP)
IPv4 54.226.104.55  44.199.88.204 

Live Screenshot Hover to expand

Attention: This is a live snapshot of this website, we do not host or control it!

No direct hits
Nothing is hosted on this domain

No incoming hits
Nothing talked to this domain

Disclaimer

The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.

Recently observed hostnames on 'www.franklinpharmacyandhealthcare.com'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.

www.franklinpharmacyandhealthcare.com | 2014-09-26

Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.

DNS recordsRetrieved via DNS ANY query

A 54.226.104.55 (TTL: 60)
A 44.199.88.204 (TTL: 60)

Registration information

Created August 15th, 2003
Updated September 6th, 2024
Registrar Amazon Registrar, Inc.

WHOIS for www.franklinpharmacyandhealthcare.com

Domain Name: franklinpharmacyandhealthcare.com
Registry Domain ID: 102119557_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.registrar.amazon
Registrar URL: https://registrar.amazon.com
Updated Date: 2024-09-06T18:36:01Z
Creation Date: 2003-08-15T17:33:18Z
Registrar Registration Expiration Date: 2026-08-15T17:33:18Z
Registrar: Amazon Registrar, Inc.
Registrar IANA ID: 468
Registrar Abuse Contact Email: trustandsafety@support.aws.com
Registrar Abuse Contact Phone: +1.2024422253
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: On behalf of franklinpharmacyandhealthcare.com owner
Registrant Organization: Identity Protection Service
Registrant Street: PO Box 786
Registrant City: Hayes
Registrant State/Province: Middlesex
Registrant Postal Code: UB3 9TR
Registrant Country: GB
Registrant Phone: +44.1483307527
Registrant Phone Ext:
Registrant Fax: +44.1483304031
Registrant Fax Ext:
Registrant Email: 0f4fce66-afe0-44e8-81a1-8a9375d0e395@identity-protect.org
Registry Tech ID: Not Available From Registry
Tech Name: On behalf of franklinpharmacyandhealthcare.com owner
Tech Organization: Identity Protection Service
Tech Street: PO Box 786
Tech City: Hayes
Tech State/Province: Middlesex
Tech Postal Code: UB3 9TR
Tech Country: GB
Tech Phone: +44.1483307527
Tech Phone Ext:
Tech Fax: +44.1483304031
Tech Fax Ext:
Tech Email: 0f4fce66-afe0-44e8-81a1-8a9375d0e395@identity-protect.org
Name Server: NS-383.AWSDNS-47.COM
Name Server: NS-826.AWSDNS-39.NET
Name Server: NS-1268.AWSDNS-30.ORG
Name Server: NS-1924.AWSDNS-48.CO.UK
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2024-12-28T12:47:06Z <<<
For more information on Whois status codes, please visit https://icann.org/epp

By submitting a query to the Amazon Registrar, Inc. WHOIS database, you
agree to abide by the following terms. The data in Amazon Registrar, Inc.'s
WHOIS database is provided by Amazon Registrar, Inc. for the sole purpose of
assisting you in obtaining information about domain name accuracy. You agree
to use this data only for lawful purposes and further agree not to use this
data for any unlawful purpose or to: (1) enable, allow, or otherwise support
the transmission by email, telephone, or facsimile of commercial advertising
or unsolicited bulk email, or (2) enable high volume, automated, electronic
processes to collect or compile this data for any purpose, including mining
this data for your own personal or commercial purposes. Amazon Registrar, Inc.
reserves the right to restrict or terminate your access to the data if you fail
to abide by these terms of use. Amazon Registrar, Inc. reserves the right
to modify these terms at any time.

Visit Amazon Registrar, Inc. at https://registrar.amazon.com

Contact information available here:
https://docs.aws.amazon.com/Route53/latest/DeveloperGuide/domain-contact-support.html

© 2020, Amazon.com, Inc., or its affiliates