www.franklinpharmacyandhealthcare.com
AMAZON-AES, US
Not observed on urlscan.io
General Info Open in Search
Geo | Ashburn, Virginia, United States (US) — |
Created | August 15th, 2003 |
Domain | franklinpharmacyandhealthcare.com (The registered domain) |
AS | AS14618 - AMAZON-AES, US
Note: An IP might be announced by multiple ASs. This is not shown. |
Route | 54.224.0.0/14 (Route of ASN) |
PTR | ec2-54-226-104-55.compute-1.amazonaws.com(PTR record of primary IP) |
IPv4 | 54.226.104.55 44.199.88.204 |
No direct hits
Nothing is hosted on this domain
No incoming hits
Nothing talked to this domain
Disclaimer
The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.
Recently observed hostnames on 'www.franklinpharmacyandhealthcare.com'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.
www.franklinpharmacyandhealthcare.com
| 2014-09-26
Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.
DNS recordsRetrieved via DNS ANY query
A |
54.226.104.55
(TTL: 60)
|
A |
44.199.88.204
(TTL: 60)
|
Registration information
Created | August 15th, 2003 |
Updated | September 6th, 2024 |
Registrar | Amazon Registrar, Inc. |
WHOIS for www.franklinpharmacyandhealthcare.com
Domain Name: franklinpharmacyandhealthcare.com Registry Domain ID: 102119557_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.registrar.amazon Registrar URL: https://registrar.amazon.com Updated Date: 2024-09-06T18:36:01Z Creation Date: 2003-08-15T17:33:18Z Registrar Registration Expiration Date: 2026-08-15T17:33:18Z Registrar: Amazon Registrar, Inc. Registrar IANA ID: 468 Registrar Abuse Contact Email: trustandsafety@support.aws.com Registrar Abuse Contact Phone: +1.2024422253 Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited Registry Registrant ID: Not Available From Registry Registrant Name: On behalf of franklinpharmacyandhealthcare.com owner Registrant Organization: Identity Protection Service Registrant Street: PO Box 786 Registrant City: Hayes Registrant State/Province: Middlesex Registrant Postal Code: UB3 9TR Registrant Country: GB Registrant Phone: +44.1483307527 Registrant Phone Ext: Registrant Fax: +44.1483304031 Registrant Fax Ext: Registrant Email: 0f4fce66-afe0-44e8-81a1-8a9375d0e395@identity-protect.org Registry Tech ID: Not Available From Registry Tech Name: On behalf of franklinpharmacyandhealthcare.com owner Tech Organization: Identity Protection Service Tech Street: PO Box 786 Tech City: Hayes Tech State/Province: Middlesex Tech Postal Code: UB3 9TR Tech Country: GB Tech Phone: +44.1483307527 Tech Phone Ext: Tech Fax: +44.1483304031 Tech Fax Ext: Tech Email: 0f4fce66-afe0-44e8-81a1-8a9375d0e395@identity-protect.org Name Server: NS-383.AWSDNS-47.COM Name Server: NS-826.AWSDNS-39.NET Name Server: NS-1268.AWSDNS-30.ORG Name Server: NS-1924.AWSDNS-48.CO.UK DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2024-12-28T12:47:06Z <<< For more information on Whois status codes, please visit https://icann.org/epp By submitting a query to the Amazon Registrar, Inc. WHOIS database, you agree to abide by the following terms. The data in Amazon Registrar, Inc.'s WHOIS database is provided by Amazon Registrar, Inc. for the sole purpose of assisting you in obtaining information about domain name accuracy. You agree to use this data only for lawful purposes and further agree not to use this data for any unlawful purpose or to: (1) enable, allow, or otherwise support the transmission by email, telephone, or facsimile of commercial advertising or unsolicited bulk email, or (2) enable high volume, automated, electronic processes to collect or compile this data for any purpose, including mining this data for your own personal or commercial purposes. Amazon Registrar, Inc. reserves the right to restrict or terminate your access to the data if you fail to abide by these terms of use. Amazon Registrar, Inc. reserves the right to modify these terms at any time. Visit Amazon Registrar, Inc. at https://registrar.amazon.com Contact information available here: https://docs.aws.amazon.com/Route53/latest/DeveloperGuide/domain-contact-support.html © 2020, Amazon.com, Inc., or its affiliates