www.diginweb.site
AS-HOSTINGER Hostinger International Limited, CY
Seen 99 times between April 20th, 2024 and December 17th, 2024.
General Info Open in Search
Geo | Lithuania (LT) — |
Created | February 21st, 2024 |
Domain | diginweb.site (The registered domain) |
AS | AS47583 - AS-HOSTINGER Hostinger International Limited, CY
Note: An IP might be announced by multiple ASs. This is not shown. |
Route | 88.222.208.0/20 (Route of ASN) |
PTR | 88-222-210-51.init.lt(PTR record of primary IP) |
IPv4 | 88.222.210.51 |
IPv6 | 2a02:4780:11:1658:0:3b8d:18cc:10 |
No direct hits
Nothing is hosted on this domain
Incoming hits
Summary of pages that talked to this domain
ASNs AS47583 | 99x
IPs 2a02:4780:11:787:0:3b8d:18cc:10 | 35x 2a02:4780:11:1658:0:3b8d:18cc:10 | 19x 2a02:4780:11:1743:0:3b8d:18cc:10 | 17x 88.222.210.51 | 8x 82.112.232.222 | 5x 217.21.94.50 | 3x 154.41.250.201 | 1x 154.62.105.20 | 1x 195.35.60.237 | 1x 2a02:4780:1d:f28a:a25a:65a:8ee:2534 | 1x
Domains aquawhiteenterprises.diginweb.site | 8x globalagrohub.diginweb.site | 6x amazingcropscience.diginweb.site | 5x lifehealthcare.online | 5x neurophysiotherapyclinic.diginweb.site | 5x thebulltribe.diginweb.site | 5x elitecarerefrigeration.diginweb.site | 4x maasaraswaticoachingclasses.diginweb.site | 4x mobs.diginweb.site | 4x trucksonroad.diginweb.site | 4x
Countries IN | 74x LT | 8x US | 7x GB | 5x NL | 3x CY | 2x
Recent scans (99 total) Show all
URL | Age | |||||
---|---|---|---|---|---|---|
sagartaxiservicemussoorie.diginweb.site/1732933009.html | 18 hours | 61 | 5 | 3 | ||
shaineshvarvivaahsamasyanivaarankendra.diginweb.site/1732086520.html | 19 hours | 57 | 6 | 5 | ||
elitecarerefrigeration.diginweb.site/1732356799.html | 20 hours | 54 | 5 | 2 | ||
growfinance.diginweb.site/1733154778.html | 3 days | 52 | 5 | 2 | ||
mysticink.diginweb.site/1732954844.html | 3 days | 60 | 6 | 5 |
Disclaimer
The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.
Recently observed hostnames on 'www.diginweb.site'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.
www.diginweb.site
| 2024-02-21
Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.
WHOIS for www.diginweb.site
Domain Name: DIGINWEB.SITE Registry Domain ID: Not Available From Registry Registrar WHOIS Server: whois.hostinger.com Registrar URL: https://www.hostinger.com Updated Date: 2024-04-22T02:16:21Z Creation Date: 2024-02-21T02:52:52Z Registrar Registration Expiration Date: 2025-02-21T23:59:59Z Registrar: Hostinger Operations, UAB Registrar IANA ID: H2712453 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Registry Registrant ID: Not Available From Registry Registrant Name: Domain Admin Registrant Organization: Privacy Protect, LLC (PrivacyProtect.org) Registrant Street: 10 Corporate Drive Note - All Postal Mails Rejected, visit Privacyprotect.org Registrant City: Burlington Registrant State/Province: MA Registrant Postal Code: 01803 Registrant Country: US Registrant Phone: +1.8022274003 Registrant Phone Ext: Registrant Fax: Registrant Fax Ext: Registrant Email: contact@privacyprotect.org Registry Admin ID: Not Available From Registry Admin Name: Domain Admin Admin Organization: Privacy Protect, LLC (PrivacyProtect.org) Admin Street: 10 Corporate Drive Note - All Postal Mails Rejected, visit Privacyprotect.org Admin City: Burlington Admin State/Province: MA Admin Postal Code: 01803 Admin Country: US Admin Phone: +1.8022274003 Admin Phone Ext: Admin Fax: Admin Fax Ext: Admin Email: contact@privacyprotect.org Registry Tech ID: Not Available From Registry Tech Name: Domain Admin Tech Organization: Privacy Protect, LLC (PrivacyProtect.org) Tech Street: 10 Corporate Drive Note - All Postal Mails Rejected, visit Privacyprotect.org Tech City: Burlington Tech State/Province: MA Tech Postal Code: 01803 Tech Country: US Tech Phone: +1.8022274003 Tech Phone Ext: Tech Fax: Tech Fax Ext: Tech Email: contact@privacyprotect.org Name Server: ns1.dns-parking.com Name Server: ns2.dns-parking.com DNSSEC: Unsigned Registrar Abuse Contact Email: abuse@hostinger.com Registrar Abuse Contact Phone: +37064503378 URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2024-12-18T09:35:10Z <<< For more information on Whois status codes, please visit https://icann.org/epp Registration Service Provided By: HOSTINGER.IN PRIVACYPROTECT.ORG is providing privacy protection services to this domain name to protect the owner from spam and phishing attacks. PrivacyProtect.org is not responsible for any of the activities associated with this domain name. If you wish to report any abuse concerning the usage of this domain name, you may do so at http://privacyprotect.org/contact. We have a stringent abuse policy and any complaint will be actioned within a short period of time. The data in this whois database is provided to you for information purposes only, that is, to assist you in obtaining information about or related to a domain name registration record. We make this information available "as is", and do not guarantee its accuracy. By submitting a whois query, you agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to: (1) enable high volume, automated, electronic processes that stress or load this whois database system providing you this information; or (2) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via direct mail, electronic mail, or by telephone. The compilation, repackaging, dissemination or other use of this data is expressly prohibited without prior written consent from us. The Registrar of record is Hostinger Operations, UAB. We reserve the right to modify these terms at any time. By submitting this query, you agree to abide by these terms.