whitemediaagency.com


Seen 37 times between June 24th, 2020 and March 8th, 2022.


General Info Open in Search

Live Screenshot Hover to expand

Attention: This is a live snapshot of this website, we do not host or control it!

Direct hits
Summary of pages hosted on this domain

IPs 162.214.30.176 | 1x

Domains whitemediaagency.com | 1x

Recent scans (1 total) Show all

URL Age
whitemediaagency.com 4 years

Incoming hits
Summary of pages that talked to this domain

ASNs AS46606 | 32x AS14061 | 3x AS31034 | 1x

IPs 162.214.30.176 | 32x 5.101.110.225 | 2x 5.101.109.44 | 1x 89.46.109.55 | 1x

Domains spiritualitybootcamp.com | 6x kristenwhite.net | 4x www.authenticvoicemedia.com | 4x bluestandard.eco | 3x kristenwhitemedia.com | 3x ndow.spiritualitybootcamp.com | 3x ams3.digitaloceanspaces.com | 2x brian.rosenthal.spiritualitybootcamp.com | 2x cathy.binck.spiritualitybootcamp.com | 2x michael.roche.spiritualitybootcamp.com | 2x

Countries US | 32x NL | 3x IT | 1x

Recent scans (36 total) Show all

URL Age
kristenwhite.net 3 years
www.authenticvoicemedia.com 3 years
www.authenticvoicemedia.com 3 years
scott.mcisaac.spiritualitybootcamp.com/q/?id=kl383615,Z153836,I381536&rd=www.... 4 years
spiritualitybootcamp.com/cgi-sys/defaultwebpage.cgi 4 years

Disclaimer

The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.

Recent screenshots
Screenshots of pages hosted on this domain

Related infrastructure
Summary of infrastructure which pages hosted on this domain frequently talked to

IPs 162.214.30.176 | 1x

Domains whitemediaagency.com | 1x

Recently observed hostnames on 'whitemediaagency.com'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.

www.rockthestagespeakers.whitemediaagency.com | 2022-09-13 www.orangecatcontent.whitemediaagency.com | 2022-09-07 rockthestagepageandscreen.whitemediaagency.com | 2022-08-30 www.rockthestagepageandscreen.whitemediaagency.com | 2022-08-30 irseater.whitemediaagency.com | 2021-07-28 www.irseater.whitemediaagency.com | 2021-07-28 freqwellco.whitemediaagency.com | 2021-07-04 www.freqwellco.whitemediaagency.com | 2021-07-04 frequencywellnessco.whitemediaagency.com | 2021-06-05 www.frequencywellnessco.whitemediaagency.com | 2021-06-05 sacredwanderlust.whitemediaagency.com | 2021-02-21 www.sacredwanderlust.whitemediaagency.com | 2021-02-21 tvfilmwritingworkshop.whitemediaagency.com | 2020-11-04 www.tvfilmwritingworkshop.whitemediaagency.com | 2020-11-04 bluestandard-eco.whitemediaagency.com | 2020-07-30 enlightenment-entertainment.whitemediaagency.com | 2020-07-30 kwvmagency.whitemediaagency.com | 2020-07-30 www.bluestandard-eco.whitemediaagency.com | 2020-07-30 www.enlightenment-entertainment.whitemediaagency.com | 2020-07-30 www.kwvmagency.whitemediaagency.com | 2020-07-30 virtualthoughtleaderagency.whitemediaagency.com | 2020-05-08 www.virtualthoughtleaderagency.whitemediaagency.com | 2020-05-08 perushamanretreat.whitemediaagency.com | 2020-05-08 rockthebookmarketing.whitemediaagency.com | 2020-05-08 rockthestagespeakersagency.whitemediaagency.com | 2020-05-08 www.perushamanretreat.whitemediaagency.com | 2020-05-08 www.rockthebookmarketing.whitemediaagency.com | 2020-05-08 www.rockthestagespeakersagency.whitemediaagency.com | 2020-05-08 prospeakersdirectory.whitemediaagency.com | 2020-05-08 rockthebrandagency.whitemediaagency.com | 2020-05-08 whiteagencyspeakers.whitemediaagency.com | 2020-05-08 www.prospeakersdirectory.whitemediaagency.com | 2020-05-08 www.rockthebrandagency.whitemediaagency.com | 2020-05-08 www.whiteagencyspeakers.whitemediaagency.com | 2020-05-08 server.whitemediaagency.com | 2019-09-18 www.server.whitemediaagency.com | 2019-09-18 johnwhitehorse.whitemediaagency.com | 2019-05-02 www.johnwhitehorse.whitemediaagency.com | 2019-05-02 kristenwhitemediacoach.whitemediaagency.com | 2018-07-20 mandalashow.whitemediaagency.com | 2018-07-20 rippleeffectmessenger.whitemediaagency.com | 2018-07-20 www.kristenwhitemediacoach.whitemediaagency.com | 2018-07-20 www.mandalashow.whitemediaagency.com | 2018-07-20 www.rippleeffectmessenger.whitemediaagency.com | 2018-07-20 18tofame.whitemediaagency.com | 2018-07-20 divorcebyenlightenment.whitemediaagency.com | 2018-07-20 enlightenmentbydivorce.whitemediaagency.com | 2018-07-20 rockthestagelasvegas.whitemediaagency.com | 2018-07-20 templates.whitemediaagency.com | 2018-07-20 thewhitemediaagency.whitemediaagency.com | 2018-07-20

Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.

Related screenshots
Screenshots of pages that talked to this domain

WHOIS for whitemediaagency.com

IP Address Has Reached Rate Limit