webappsecurenewverifyngaccmangespaymets.maryabio.com
NETWORK-SOLUTIONS-HOSTING, US
Seen 2 times between July 20th, 2024 and July 21st, 2024.
General Info Open in Search
Geo | United States (US) — |
Created | November 16th, 2023 |
Domain | maryabio.com (The registered domain) |
AS | AS19871 - NETWORK-SOLUTIONS-HOSTING, US
Note: An IP might be announced by multiple ASs. This is not shown. |
Route | 162.241.124.0/22 (Route of ASN) |
PTR | 162-241-126-194.webhostbox.net(PTR record of primary IP) |
IPv4 | 162.241.126.194 |
Direct hits
Summary of pages hosted on this domain
IPs 162.241.126.194 | 1x
Domains webappsecurenewverifyngaccmangespaymets.maryabio.com | 1x
Recent scans (1 total) Show all
URL | Age | |||||
---|---|---|---|---|---|---|
webappsecurenewverifyngaccmangespaymets.maryabio.com | 6 months | 2 | 1 | 1 |
Incoming hits
Summary of pages that talked to this domain
ASNs AS16509 | 1x
IPs 2600:9000:24f1:5600:7:49a5:5fd3:b641 | 1x
Domains www.amazon.com | 1x
Countries US | 1x
Recent scans (1 total) Show all
URL | Age | |||||
---|---|---|---|---|---|---|
www.amazon.com/ap/signin | 6 months | 23 | 6 | 1 |
Disclaimer
The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.
Recent screenshots
Screenshots of pages hosted on this domain
Related infrastructure
Summary of infrastructure which pages hosted on this domain frequently talked to
IPs 162.241.126.194 | 1x
Domains webappsecurenewverifyngaccmangespaymets.maryabio.com | 1x
Recently observed hostnames on 'webappsecurenewverifyngaccmangespaymets.maryabio.com'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.
webappsecurenewverifyngaccmangespaymets.maryabio.com
| 2024-07-19
Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.
DNS recordsRetrieved via DNS ANY query
A |
162.241.126.194
(TTL: 14400)
|
Registration information
Created | November 16th, 2023 |
Updated | November 28th, 2024 |
Registrar | PDR Ltd. d/b/a PublicDomainRegistry.com |
WHOIS for webappsecurenewverifyngaccmangespaymets.maryabio.com
Domain Name: MARYABIO.COM Registry Domain ID: 18403947-maryabio.com Registrar WHOIS Server: whois.publicdomainregistry.com Registrar URL: www.publicdomainregistry.com Updated Date: 2024-11-28T11:09:14Z Creation Date: 2023-11-16T19:20:30Z Registrar Registration Expiration Date: 2025-11-16T19:20:30Z Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com Registrar IANA ID: 303 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Registry Registrant ID: Not Available From Registry Registrant Name: Zineb Bouilughmane Registrant Organization: Registrant Street: 561 HAY ELWAHDA Registrant City: OUARAZAZATE Registrant State/Province: OUARAZAZATE Registrant Postal Code: 45000 Registrant Country: MA Registrant Phone: +212.643583276 Registrant Phone Ext: Registrant Fax: Registrant Fax Ext: Registrant Email: marybiowarz@gmail.com Registry Admin ID: Not Available From Registry Admin Name: Zineb Bouilughmane Admin Organization: Admin Street: 561 HAY ELWAHDA Admin City: OUARAZAZATE Admin State/Province: OUARAZAZATE Admin Postal Code: 45000 Admin Country: MA Admin Phone: +212.643583276 Admin Phone Ext: Admin Fax: Admin Fax Ext: Admin Email: marybiowarz@gmail.com Registry Tech ID: Not Available From Registry Tech Name: Zineb Bouilughmane Tech Organization: Tech Street: 561 HAY ELWAHDA Tech City: OUARAZAZATE Tech State/Province: OUARAZAZATE Tech Postal Code: 45000 Tech Country: MA Tech Phone: +212.643583276 Tech Phone Ext: Tech Fax: Tech Fax Ext: Tech Email: marybiowarz@gmail.com Name Server: ns5.comimo.com Name Server: ns6.comimo.com DNSSEC: Unsigned Registrar Abuse Contact Email: abuse-contact@publicdomainregistry.com Registrar Abuse Contact Phone: +1.2013775952 URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2025-01-16T08:31:14Z <<< For more information on Whois status codes, please visit https://icann.org/epp Registration Service Provided By: HEBERMAT The data in this whois database is provided to you for information purposes only, that is, to assist you in obtaining information about or related to a domain name registration record. We make this information available "as is", and do not guarantee its accuracy. By submitting a whois query, you agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to: (1) enable high volume, automated, electronic processes that stress or load this whois database system providing you this information; or (2) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via direct mail, electronic mail, or by telephone. The compilation, repackaging, dissemination or other use of this data is expressly prohibited without prior written consent from us. The Registrar of record is PDR Ltd. d/b/a PublicDomainRegistry.com. We reserve the right to modify these terms at any time. By submitting this query, you agree to abide by these terms.