webappsecurenewverifyngaccmangespaymets.maryabio.com
NETWORK-SOLUTIONS-HOSTING, US


Seen 2 times between July 20th, 2024 and July 21st, 2024.


General Info Open in Search

Geo United States (US) —
Created November 16th, 2023
Domain maryabio.com (The registered domain)
AS AS19871 - NETWORK-SOLUTIONS-HOSTING, US
Note: An IP might be announced by multiple ASs. This is not shown.
Route 162.241.124.0/22 (Route of ASN)
PTR 162-241-126-194.webhostbox.net(PTR record of primary IP)
IPv4 162.241.126.194 

Live Screenshot Hover to expand

Attention: This is a live snapshot of this website, we do not host or control it!

Direct hits
Summary of pages hosted on this domain

IPs 162.241.126.194 | 1x

Domains webappsecurenewverifyngaccmangespaymets.maryabio.com | 1x

Recent scans (1 total) Show all

URL Age
webappsecurenewverifyngaccmangespaymets.maryabio.com 6 months

Incoming hits
Summary of pages that talked to this domain

ASNs AS16509 | 1x

IPs 2600:9000:24f1:5600:7:49a5:5fd3:b641 | 1x

Domains www.amazon.com | 1x

Countries US | 1x

Recent scans (1 total) Show all

URL Age
www.amazon.com/ap/signin 6 months

Disclaimer

The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.

Recent screenshots
Screenshots of pages hosted on this domain

Related infrastructure
Summary of infrastructure which pages hosted on this domain frequently talked to

IPs 162.241.126.194 | 1x

Domains webappsecurenewverifyngaccmangespaymets.maryabio.com | 1x

Recently observed hostnames on 'webappsecurenewverifyngaccmangespaymets.maryabio.com'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.

webappsecurenewverifyngaccmangespaymets.maryabio.com | 2024-07-19

Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.

Related screenshots
Screenshots of pages that talked to this domain

DNS recordsRetrieved via DNS ANY query

A 162.241.126.194 (TTL: 14400)

Registration information

Created November 16th, 2023
Updated November 28th, 2024
Registrar PDR Ltd. d/b/a PublicDomainRegistry.com

WHOIS for webappsecurenewverifyngaccmangespaymets.maryabio.com

Domain Name: MARYABIO.COM
Registry Domain ID: 18403947-maryabio.com
Registrar WHOIS Server: whois.publicdomainregistry.com
Registrar URL: www.publicdomainregistry.com
Updated Date: 2024-11-28T11:09:14Z
Creation Date: 2023-11-16T19:20:30Z
Registrar Registration Expiration Date: 2025-11-16T19:20:30Z
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registrar IANA ID: 303
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Zineb Bouilughmane
Registrant Organization: 
Registrant Street: 561 HAY ELWAHDA   
Registrant City: OUARAZAZATE
Registrant State/Province: OUARAZAZATE
Registrant Postal Code: 45000
Registrant Country: MA
Registrant Phone: +212.643583276
Registrant Phone Ext: 
Registrant Fax: 
Registrant Fax Ext: 
Registrant Email: marybiowarz@gmail.com
Registry Admin ID: Not Available From Registry
Admin Name: Zineb Bouilughmane
Admin Organization: 
Admin Street: 561 HAY ELWAHDA  
Admin City: OUARAZAZATE
Admin State/Province: OUARAZAZATE
Admin Postal Code: 45000
Admin Country: MA
Admin Phone: +212.643583276
Admin Phone Ext: 
Admin Fax: 
Admin Fax Ext: 
Admin Email: marybiowarz@gmail.com
Registry Tech ID: Not Available From Registry
Tech Name: Zineb Bouilughmane
Tech Organization: 
Tech Street: 561 HAY ELWAHDA  
Tech City: OUARAZAZATE
Tech State/Province: OUARAZAZATE
Tech Postal Code: 45000
Tech Country: MA
Tech Phone: +212.643583276
Tech Phone Ext: 
Tech Fax: 
Tech Fax Ext: 
Tech Email: marybiowarz@gmail.com
Name Server: ns5.comimo.com
Name Server: ns6.comimo.com
DNSSEC: Unsigned
Registrar Abuse Contact Email: abuse-contact@publicdomainregistry.com
Registrar Abuse Contact Phone: +1.2013775952
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2025-01-16T08:31:14Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

Registration Service Provided By: HEBERMAT

The data in this whois database is provided to you for information purposes 
only, that is, to assist you in obtaining information about or related to a 
domain name registration record. We make this information available "as is",
and do not guarantee its accuracy. By submitting a whois query, you agree 
that you will use this data only for lawful purposes and that, under no 
circumstances will you use this data to: 
(1) enable high volume, automated, electronic processes that stress or load 
this whois database system providing you this information; or 
(2) allow, enable, or otherwise support the transmission of mass unsolicited, 
commercial advertising or solicitations via direct mail, electronic mail, or 
by telephone. 
The compilation, repackaging, dissemination or other use of this data is 
expressly prohibited without prior written consent from us. The Registrar of 
record is PDR Ltd. d/b/a PublicDomainRegistry.com. 
We reserve the right to modify these terms at any time. 
By submitting this query, you agree to abide by these terms.