webappsecurenewpaymnetsmangesaccverifyng.jcian.com
VIEWQWEST-SG-AP Viewqwest Pte Ltd, SG


Seen 2 times between August 9th, 2024 and August 12th, 2024.


General Info Open in Search

Geo Singapore, Singapore (SG) —
Domain jcian.com (The registered domain)
AS AS18106 - VIEWQWEST-SG-AP Viewqwest Pte Ltd, SG
Note: An IP might be announced by multiple ASs. This is not shown.
Route 132.147.64.0/18 (Route of ASN)
PTR fnet200-f69-access.vqbn.com.sg(PTR record of primary IP)
IPv4 132.147.69.200 

Live Screenshot Hover to expand

Attention: This is a live snapshot of this website, we do not host or control it!

Direct hits
Summary of pages hosted on this domain

IPs 132.147.69.200 | 1x

Domains webappsecurenewpaymnetsmangesaccverifyng.jcian.com | 1x

Recent scans (1 total) Show all

URL Age
webappsecurenewpaymnetsmangesaccverifyng.jcian.com 5 months

Incoming hits
Summary of pages that talked to this domain

ASNs AS20940 | 1x

IPs 2a02:26f0:480:59a::3bd4 | 1x

Domains www.amazon.com | 1x

Countries DE | 1x

Recent scans (1 total) Show all

URL Age
www.amazon.com/ap/signin 5 months

Disclaimer

The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.

Recent screenshots
Screenshots of pages hosted on this domain

Related infrastructure
Summary of infrastructure which pages hosted on this domain frequently talked to

IPs 132.147.69.200 | 1x

Domains webappsecurenewpaymnetsmangesaccverifyng.jcian.com | 1x

Recently observed hostnames on 'webappsecurenewpaymnetsmangesaccverifyng.jcian.com'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.

webappsecurenewpaymnetsmangesaccverifyng.jcian.com | 2024-08-08

Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.

Related screenshots
Screenshots of pages that talked to this domain