raptoreum.top
Seen 3 times between November 10th, 2021 and June 10th, 2024.
General Info Open in Search
Direct hits
Summary of pages hosted on this domain
IPs 2606:4700:3031::ac43:b48b | 2x 172.67.180.139 | 1x
Domains raptoreum.top | 3x
Recent scans (3 total) Show all
URL | Age | |||||
---|---|---|---|---|---|---|
raptoreum.top/zwkykfescgafgfgaegpvsretkpvtwhlwfxvrcahfgjlqqt.zip | 7 months | 8 | 2 | 1 | ||
raptoreum.top/zwkykfescgafgfgaegpvsretkpvtwhlwfxvrcahfgjlqqt.zip | 9 months | 8 | 3 | 1 | ||
raptoreum.top | 3 years | 2 | 1 | 1 |
No incoming hits
Nothing talked to this domain
Disclaimer
The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.
Recent screenshots
Screenshots of pages hosted on this domain
Related infrastructure
Summary of infrastructure which pages hosted on this domain frequently talked to
IPs 2606:4700:3031::ac43:b48b | 2x 172.67.180.139 | 1x
Domains raptoreum.top | 3x
Recently observed hostnames on 'raptoreum.top'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.
raptoreum.top
| 2021-11-07
Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.