mindframeglobal.com
AS-HOSTINGER Hostinger International Limited, CY


Seen 10 times between October 2nd, 2020 and July 1st, 2024.


General Info Open in Search

Geo Lithuania (LT) —
AS AS47583 - AS-HOSTINGER Hostinger International Limited, CY
Note: An IP might be announced by multiple ASs. This is not shown.
Route 84.32.84.0/24 (Route of ASN)
IPv4 84.32.84.237 
IPv6 2a02:4780:43:b0c6:3739:7b93:20b0:8334

Live Screenshot Hover to expand

Attention: This is a live snapshot of this website, we do not host or control it!

Direct hits
Summary of pages hosted on this domain

IPs 119.18.49.33 | 3x 35.213.183.175 | 2x

Domains mindframeglobal.com | 2x cpanel.new.mindframeglobal.com | 1x webmail.mindframeglobal.com | 1x webmail.new.mindframeglobal.com | 1x

Recent scans (5 total) Show all

URL Age
cpanel.new.mindframeglobal.com 10 months
webmail.new.mindframeglobal.com 10 months
webmail.mindframeglobal.com a year
mindframeglobal.com 2 years
mindframeglobal.com 2 years

Incoming hits
Summary of pages that talked to this domain

ASNs AS8075 | 2x AS29873 | 1x AS394695 | 1x AS7393 | 1x

IPs 20.244.117.111 | 2x 66.96.147.101 | 1x 66.201.110.187 | 1x 111.118.215.65 | 1x

Domains www.gichfindia.com | 2x adityabirlahospital.com | 1x equipay.co | 1x gichfindia.com | 1x

Countries IN | 3x US | 2x

Recent scans (5 total) Show all

URL Age
gichfindia.com 6 months
www.gichfindia.com 7 months
www.gichfindia.com 3 years
equipay.co 4 years
adityabirlahospital.com 4 years

Disclaimer

The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.

Recent screenshots
Screenshots of pages hosted on this domain

Related infrastructure
Summary of infrastructure which pages hosted on this domain frequently talked to

IPs 119.18.49.33 | 3x 35.213.183.175 | 2x

Domains mindframeglobal.com | 2x cpanel.new.mindframeglobal.com | 1x webmail.mindframeglobal.com | 1x webmail.new.mindframeglobal.com | 1x

Recently observed hostnames on 'mindframeglobal.com'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.

enquiry.mindframeglobal.com | 2024-11-29 new.mindframeglobal.com | 2024-02-28 www.new.mindframeglobal.com | 2024-02-28 autodiscover.mindframeglobal.com | 2024-01-26 cpanel.mindframeglobal.com | 2024-01-26 cpcalendars.mindframeglobal.com | 2024-01-26 cpcontacts.mindframeglobal.com | 2024-01-26 mail.mindframeglobal.com | 2024-01-26 webdisk.mindframeglobal.com | 2024-01-26 webmail.mindframeglobal.com | 2024-01-26 bizzfinity.mindframeglobal.com | 2021-06-16 www.bizzfinity.mindframeglobal.com | 2021-06-16 cupidlounge.mindframeglobal.com | 2021-06-16 www.cupidlounge.mindframeglobal.com | 2021-06-16 dairychain.mindframeglobal.com | 2021-06-16 www.dairychain.mindframeglobal.com | 2021-06-16 desijhatka.mindframeglobal.com | 2021-06-16 www.desijhatka.mindframeglobal.com | 2021-06-16 ezeeforex.mindframeglobal.com | 2021-06-16 www.ezeeforex.mindframeglobal.com | 2021-06-16 flourandbatter.mindframeglobal.com | 2021-06-16 www.flourandbatter.mindframeglobal.com | 2021-06-16 gurumantar.mindframeglobal.com | 2021-06-16 www.gurumantar.mindframeglobal.com | 2021-06-16 indiasnext.mindframeglobal.com | 2021-06-16 www.indiasnext.mindframeglobal.com | 2021-06-16 indiasnextchampion.mindframeglobal.com | 2021-06-16 www.indiasnextchampion.mindframeglobal.com | 2021-06-16 kicksmartindia.mindframeglobal.com | 2021-06-16 www.kicksmartindia.mindframeglobal.com | 2021-06-16 leadershipmavericks.mindframeglobal.com | 2021-06-16 www.leadershipmavericks.mindframeglobal.com | 2021-06-16 mindframeindia.mindframeglobal.com | 2021-06-16 www.mindframeindia.mindframeglobal.com | 2021-06-16 noor.mindframeglobal.com | 2021-06-16 www.noor.mindframeglobal.com | 2021-06-16 persiandarbar.mindframeglobal.com | 2021-06-16 www.persiandarbar.mindframeglobal.com | 2021-06-16 ravikchandran.mindframeglobal.com | 2021-06-16 www.ravikchandran.mindframeglobal.com | 2021-06-16 rehanamannan.mindframeglobal.com | 2021-06-16 www.rehanamannan.mindframeglobal.com | 2021-06-16 thekickfoundation.mindframeglobal.com | 2021-06-16 www.thekickfoundation.mindframeglobal.com | 2021-06-16 thesuperkids.mindframeglobal.com | 2021-06-16 www.thesuperkids.mindframeglobal.com | 2021-06-16 truvicindustries.mindframeglobal.com | 2021-06-16 www.truvicindustries.mindframeglobal.com | 2021-06-16 vengsarkaracademy.mindframeglobal.com | 2021-06-16 www.vengsarkaracademy.mindframeglobal.com | 2021-06-16

Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.

Related screenshots
Screenshots of pages that talked to this domain

WHOIS for mindframeglobal.com

Rate limit exceeded. Try again after: 24h0m0s