marksandspencertravelins.myclaimshub.co.uk


Not observed on urlscan.io


General Info Open in Search

Domain myclaimshub.co.uk (The registered domain)

Live Screenshot Hover to expand

Attention: This is a live snapshot of this website, we do not host or control it!

No direct hits
Nothing is hosted on this domain

No incoming hits
Nothing talked to this domain

Disclaimer

The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.

Recently observed hostnames on 'marksandspencertravelins.myclaimshub.co.uk'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.

marksandspencertravelins.myclaimshub.co.uk | 2020-01-25 www.marksandspencertravelins.myclaimshub.co.uk | 2020-01-25

Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.

WHOIS for marksandspencertravelins.myclaimshub.co.uk

Error for "myclaimshub.co.uk".

the WHOIS query quota for 116.202.166.126 has been exceeded
and will be replenished in 37 seconds

WHOIS lookup made at 02:46:38 07-Nov-2024

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

    Copyright Nominet UK 1996 - 2024.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at https://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.