loridigitalspecialneedsmama.newdfybiz.com
AMAZON-02, US
Seen 2 times between August 23rd, 2024 and September 24th, 2024.
General Info Open in Search
Geo | United States (US) — |
Domain | newdfybiz.com (The registered domain) |
AS | AS16509 - AMAZON-02, US
Note: An IP might be announced by multiple ASs. This is not shown. |
Route | 13.32.24.0/21 (Route of ASN) |
PTR | server-13-32-27-119.fra56.r.cloudfront.net(PTR record of primary IP) |
IPv4 | 13.32.27.119 13.32.27.31 13.32.27.68 13.32.27.89 |
IPv6 | 2600:9000:2644:6c00:14:7fc6:f2c0:93a1 2600:9000:2644:3e00:14:7fc6:f2c0:93a1 2600:9000:2644:7600:14:7fc6:f2c0:93a1 2600:9000:2644:9000:14:7fc6:f2c0:93a1 2600:9000:2644:5200:14:7fc6:f2c0:93a1 2600:9000:2644:d200:14:7fc6:f2c0:93a1 2600:9000:2644:a400:14:7fc6:f2c0:93a1 2600:9000:2644:8000:14:7fc6:f2c0:93a1 |
Direct hits
Summary of pages hosted on this domain
IPs 2600:9000:2510:6800:14:7fc6:f2c0:93a1 | 1x 2600:9000:273b:7e00:14:7fc6:f2c0:93a1 | 1x
Domains loridigitalspecialneedsmama.newdfybiz.com | 2x
Recent scans (2 total) Show all
URL | Age | |||||
---|---|---|---|---|---|---|
loridigitalspecialneedsmama.newdfybiz.com | 2 months | 15 | 6 | 1 | ||
loridigitalspecialneedsmama.newdfybiz.com | 3 months | 14 | 6 | 1 |
No incoming hits
Nothing talked to this domain
Disclaimer
The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.
Recent screenshots
Screenshots of pages hosted on this domain
Related infrastructure
Summary of infrastructure which pages hosted on this domain frequently talked to
IPs 2600:9000:2510:6800:14:7fc6:f2c0:93a1 | 1x 2600:9000:273b:7e00:14:7fc6:f2c0:93a1 | 1x
Domains loridigitalspecialneedsmama.newdfybiz.com | 2x
Recently observed hostnames on 'loridigitalspecialneedsmama.newdfybiz.com'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.
loridigitalspecialneedsmama.newdfybiz.com
| 2024-08-09
Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.
WHOIS for loridigitalspecialneedsmama.newdfybiz.com
Rate limit exceeded. Try again after: 24h0m0s