kubucempakaseminyak.sagaravillassanur.com
HAWKHOST, CA
Seen 9 times between July 24th, 2024 and September 17th, 2024.
General Info Open in Search
Geo | Texas, United States (US) — |
Created | June 23rd, 2021 |
Domain | sagaravillassanur.com (The registered domain) |
AS | AS20068 - HAWKHOST, CA
Note: An IP might be announced by multiple ASs. This is not shown. |
Registrar | ARIN |
Route | 198.252.104.0/24 (Route of ASN) |
PTR | 198.252.104.154-static.reverse.arandomserver.com(PTR record of primary IP) |
IPv4 | 198.252.104.154 |
Direct hits
Summary of pages hosted on this domain
IPs 198.252.104.154 | 9x
Domains kubucempakaseminyak.sagaravillassanur.com | 5x www.kubucempakaseminyak.sagaravillassanur.com | 4x
Recent scans (9 total) Show all
URL | Age | |||||
---|---|---|---|---|---|---|
kubucempakaseminyak.sagaravillassanur.com | 2 months | 55 | 11 | 2 | ||
kubucempakaseminyak.sagaravillassanur.com | 2 months | 54 | 9 | 1 | ||
kubucempakaseminyak.sagaravillassanur.com | 3 months | 55 | 9 | 2 | ||
kubucempakaseminyak.sagaravillassanur.com | 3 months | 63 | 9 | 2 | ||
www.kubucempakaseminyak.sagaravillassanur.com | 3 months | 62 | 10 | 1 |
No incoming hits
Nothing talked to this domain
Disclaimer
The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.
Recent screenshots
Screenshots of pages hosted on this domain
Related infrastructure
Summary of infrastructure which pages hosted on this domain frequently talked to
IPs 198.252.104.154 | 9x
Domains kubucempakaseminyak.sagaravillassanur.com | 5x www.kubucempakaseminyak.sagaravillassanur.com | 4x
Recently observed hostnames on 'kubucempakaseminyak.sagaravillassanur.com'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.
kubucempakaseminyak.sagaravillassanur.com
| 2024-07-23
www.kubucempakaseminyak.sagaravillassanur.com
| 2024-07-23
Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.
DNS recordsRetrieved via DNS ANY query
A |
198.252.104.154
(TTL: 14400)
|
TXT |
v=spf1 +a +mx +ip4:198.252.105.6 include:_spf.arandomserver.com ~all
|
Registration information
Created | June 23rd, 2021 |
Updated | June 5th, 2024 |
Registrar | Name.com, Inc. |
WHOIS for kubucempakaseminyak.sagaravillassanur.com
Domain Name: SAGARAVILLASSANUR.COM Registry Domain ID: 2621629249_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.name.com Registrar URL: http://www.name.com Updated Date: 2024-06-05T03:46:53Z Creation Date: 2021-06-23T05:45:21Z Registrar Registration Expiration Date: 2025-06-23T05:45:21Z Registrar: Name.com, Inc. Registrar IANA ID: 625 Reseller: Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited Registry Registrant ID: Not Available From Registry Registrant Name: Redacted For Privacy Registrant Organization: Domain Protection Services, Inc. Registrant Street: PO Box 1769 Registrant City: Denver Registrant State/Province: CO Registrant Postal Code: 80201 Registrant Country: US Registrant Phone: +1.7208009072 Registrant Fax: +1.7209758725 Registrant Email: https://www.name.com/contact-domain-whois/sagaravillassanur.com Registry Admin ID: Not Available From Registry Admin Name: Redacted For Privacy Admin Organization: Domain Protection Services, Inc. Admin Street: PO Box 1769 Admin City: Denver Admin State/Province: CO Admin Postal Code: 80201 Admin Country: US Admin Phone: +1.7208009072 Admin Fax: +1.7209758725 Admin Email: https://www.name.com/contact-domain-whois/sagaravillassanur.com Registry Tech ID: Not Available From Registry Tech Name: Redacted For Privacy Tech Organization: Domain Protection Services, Inc. Tech Street: PO Box 1769 Tech City: Denver Tech State/Province: CO Tech Postal Code: 80201 Tech Country: US Tech Phone: +1.7208009072 Tech Fax: +1.7209758725 Tech Email: https://www.name.com/contact-domain-whois/sagaravillassanur.com Name Server: ns5.hawkhost.com Name Server: ns6.hawkhost.com DNSSEC: unSigned Registrar Abuse Contact Email: abuse@name.com Registrar Abuse Contact Phone: +1.7203101849 URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2024-11-12T01:17:56Z <<< For more information on Whois status codes, please visit https://icann.org/epp The data in the Name.com, Inc. WHOIS database is provided by Name.com, Inc. for information purposes, and to assist persons in obtaining information about or related to a domain name registration record. Name.com, Inc. does not guarantee its accuracy. Users accessing the Name.com, Inc. WHOIS service agree to use the data only for lawful purposes, and under no circumstances may this data be used to: a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the registrar's own existing customers and b) enable high volume, automated, electronic processes that send queries or data to the systems of Name.com, Inc., except as reasonably necessary to register domain names or modify existing registrations. When using the Name.com, Inc. WHOIS service, please consider the following: the WHOIS service is not a replacement for standard EPP commands to the SRS service. WHOIS is not considered authoritative for registered domain objects. The WHOIS service may be scheduled for downtime during production or OT&E maintenance periods. Where applicable, the presence of a [Non-Public Data] tag indicates that such data is not made publicly available due to applicable data privacy laws or requirements. Access to non-public data may be provided, upon request, where it can be reasonably confirmed that the requester holds a specific legitimate interest and a proper legal basis, for accessing the withheld data. Access to this data can be requested by submitting a request via the form found at https://www.name.com/layered-access-request . Name.com, Inc. reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.