kadivarelectricalpvtltd.madniinfoway.com
UNIFIEDLAYER-AS-1, US
Not observed on urlscan.io
General Info Open in Search
Geo | United States (US) — |
Created | November 25th, 2013 |
Domain | madniinfoway.com (The registered domain) |
AS | AS46606 - UNIFIEDLAYER-AS-1, US
Note: An IP might be announced by multiple ASs. This is not shown. |
Route | 199.79.62.0/23 (Route of ASN) |
PTR | md-82.webhostbox.net(PTR record of primary IP) |
IPv4 | 199.79.62.196 |
No direct hits
Nothing is hosted on this domain
No incoming hits
Nothing talked to this domain
Disclaimer
The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.
Recently observed hostnames on 'kadivarelectricalpvtltd.madniinfoway.com'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.
kadivarelectricalpvtltd.madniinfoway.com
| 2019-08-19
www.kadivarelectricalpvtltd.madniinfoway.com
| 2019-08-19
Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.
DNS recordsRetrieved via DNS ANY query
A |
199.79.62.196
(TTL: 14400)
|
Registration information
Created | November 25th, 2013 |
Updated | November 30th, 2023 |
Registrar | BigRock Solutions Ltd. |
WHOIS for kadivarelectricalpvtltd.madniinfoway.com
Domain Name: MADNIINFOWAY.COM Registry Domain ID: 1836770760_DOMAIN_COM-VRSN Registrar WHOIS Server: Whois.bigrock.com Registrar URL: www.bigrock.com Updated Date: 2023-11-30T05:54:30Z Creation Date: 2013-11-25T13:16:00Z Registrar Registration Expiration Date: 2025-11-25T13:16:00Z Registrar: BigRock Solutions Ltd. Registrar IANA ID: 1495 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Registry Registrant ID: Not Available From Registry Registrant Name: nasrulla Registrant Organization: Registrant Street: rajkot Registrant City: rajkot Registrant State/Province: Gujarat Registrant Postal Code: 360001 Registrant Country: IN Registrant Phone: +91.9974400561 Registrant Phone Ext: Registrant Fax: Registrant Fax Ext: Registrant Email: nasubhoraniya@gmail.com Registry Admin ID: Not Available From Registry Admin Name: nasrulla Admin Organization: Admin Street: rajkot Admin City: rajkot Admin State/Province: Gujarat Admin Postal Code: 360001 Admin Country: IN Admin Phone: +91.9974400561 Admin Phone Ext: Admin Fax: Admin Fax Ext: Admin Email: nasubhoraniya@gmail.com Registry Tech ID: Not Available From Registry Tech Name: nasrulla Tech Organization: Tech Street: rajkot Tech City: rajkot Tech State/Province: Gujarat Tech Postal Code: 360001 Tech Country: IN Tech Phone: +91.9974400561 Tech Phone Ext: Tech Fax: Tech Fax Ext: Tech Email: nasubhoraniya@gmail.com Name Server: ns1.md-82.webhostbox.net Name Server: ns2.md-82.webhostbox.net DNSSEC: Unsigned Registrar Abuse Contact Email: abuse@bigrock.com Registrar Abuse Contact Phone: +1-415-349-0015 URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2024-11-17T12:11:04Z <<< For more information on Whois status codes, please visit https://icann.org/epp Registration Service Provided By: BIGROCK The data in this whois database is provided to you for information purposes only, that is, to assist you in obtaining information about or related to a domain name registration record. We make this information available "as is", and do not guarantee its accuracy. By submitting a whois query, you agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to: (1) enable high volume, automated, electronic processes that stress or load this whois database system providing you this information; or (2) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via direct mail, electronic mail, or by telephone. The compilation, repackaging, dissemination or other use of this data is expressly prohibited without prior written consent from us. The Registrar of record is BigRock Solutions Ltd.. We reserve the right to modify these terms at any time. By submitting this query, you agree to abide by these terms.