kadivarelectricalpvtltd.madniinfoway.com
UNIFIEDLAYER-AS-1, US


Not observed on urlscan.io


General Info Open in Search

Geo United States (US) —
Created November 25th, 2013
Domain madniinfoway.com (The registered domain)
AS AS46606 - UNIFIEDLAYER-AS-1, US
Note: An IP might be announced by multiple ASs. This is not shown.
Route 199.79.62.0/23 (Route of ASN)
PTR md-82.webhostbox.net(PTR record of primary IP)
IPv4 199.79.62.196 

Live Screenshot Hover to expand

Attention: This is a live snapshot of this website, we do not host or control it!

No direct hits
Nothing is hosted on this domain

No incoming hits
Nothing talked to this domain

Disclaimer

The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.

Recently observed hostnames on 'kadivarelectricalpvtltd.madniinfoway.com'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.

kadivarelectricalpvtltd.madniinfoway.com | 2019-08-19 www.kadivarelectricalpvtltd.madniinfoway.com | 2019-08-19

Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.

DNS recordsRetrieved via DNS ANY query

A 199.79.62.196 (TTL: 14400)

Registration information

Created November 25th, 2013
Updated November 30th, 2023
Registrar BigRock Solutions Ltd.

WHOIS for kadivarelectricalpvtltd.madniinfoway.com

Domain Name: MADNIINFOWAY.COM
Registry Domain ID: 1836770760_DOMAIN_COM-VRSN
Registrar WHOIS Server: Whois.bigrock.com
Registrar URL: www.bigrock.com
Updated Date: 2023-11-30T05:54:30Z
Creation Date: 2013-11-25T13:16:00Z
Registrar Registration Expiration Date: 2025-11-25T13:16:00Z
Registrar: BigRock Solutions Ltd.
Registrar IANA ID: 1495
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: nasrulla
Registrant Organization: 
Registrant Street: rajkot   
Registrant City: rajkot
Registrant State/Province: Gujarat
Registrant Postal Code: 360001
Registrant Country: IN
Registrant Phone: +91.9974400561
Registrant Phone Ext: 
Registrant Fax: 
Registrant Fax Ext: 
Registrant Email: nasubhoraniya@gmail.com
Registry Admin ID: Not Available From Registry
Admin Name: nasrulla
Admin Organization: 
Admin Street: rajkot  
Admin City: rajkot
Admin State/Province: Gujarat
Admin Postal Code: 360001
Admin Country: IN
Admin Phone: +91.9974400561
Admin Phone Ext: 
Admin Fax: 
Admin Fax Ext: 
Admin Email: nasubhoraniya@gmail.com
Registry Tech ID: Not Available From Registry
Tech Name: nasrulla
Tech Organization: 
Tech Street: rajkot  
Tech City: rajkot
Tech State/Province: Gujarat
Tech Postal Code: 360001
Tech Country: IN
Tech Phone: +91.9974400561
Tech Phone Ext: 
Tech Fax: 
Tech Fax Ext: 
Tech Email: nasubhoraniya@gmail.com
Name Server: ns1.md-82.webhostbox.net
Name Server: ns2.md-82.webhostbox.net
DNSSEC: Unsigned
Registrar Abuse Contact Email: abuse@bigrock.com
Registrar Abuse Contact Phone: +1-415-349-0015
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2024-11-17T12:11:04Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

Registration Service Provided By: BIGROCK

The data in this whois database is provided to you for information purposes 
only, that is, to assist you in obtaining information about or related to a 
domain name registration record. We make this information available "as is",
and do not guarantee its accuracy. By submitting a whois query, you agree 
that you will use this data only for lawful purposes and that, under no 
circumstances will you use this data to: 
(1) enable high volume, automated, electronic processes that stress or load 
this whois database system providing you this information; or 
(2) allow, enable, or otherwise support the transmission of mass unsolicited, 
commercial advertising or solicitations via direct mail, electronic mail, or 
by telephone. 
The compilation, repackaging, dissemination or other use of this data is 
expressly prohibited without prior written consent from us. The Registrar of 
record is BigRock Solutions Ltd.. 
We reserve the right to modify these terms at any time. 
By submitting this query, you agree to abide by these terms.