ifvgroup.asia
EXABYTES-AS-AP Exa Bytes Network Sdn.Bhd., MY


Seen 2 times between October 10th, 2024 and November 11th, 2024.


General Info Open in Search

Geo Malaysia (MY) —
AS AS46015 - EXABYTES-AS-AP Exa Bytes Network Sdn.Bhd., MY
Note: An IP might be announced by multiple ASs. This is not shown.
Route 110.4.40.0/21 (Route of ASN)
PTR e129.mschosting.com(PTR record of primary IP)
IPv4 110.4.45.100 

Live Screenshot Hover to expand

Attention: This is a live snapshot of this website, we do not host or control it!

Direct hits
Summary of pages hosted on this domain

IPs 110.4.45.100 | 1x

Domains www.ifvgroup.asia | 1x

Recent scans (1 total) Show all

URL Age
www.ifvgroup.asia 2 months

Incoming hits
Summary of pages that talked to this domain

ASNs AS16509 | 1x

IPs 2600:9000:2057:ba00:7:49a5:5fd4:b121 | 1x

Domains www.amazon.com | 1x

Countries US | 1x

Recent scans (1 total) Show all

URL Age
www.amazon.com/ap/signin 3 months

Disclaimer

The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.

Recent screenshots
Screenshots of pages hosted on this domain

Related infrastructure
Summary of infrastructure which pages hosted on this domain frequently talked to

IPs 110.4.45.100 | 1x

Domains www.ifvgroup.asia | 1x

Recently observed hostnames on 'ifvgroup.asia'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.

intlaccmangespaymentsupportwebapps.ifvgroup.asia | 2024-10-11 webappsecurenewaccmangespaymnetsintl.ifvgroup.asia | 2024-10-10 supportwebappsrenewaccmangesverifyng.ifvgroup.asia | 2024-10-10 ifvgroup.asia | 2022-06-01 webmail.ifvgroup.asia | 2022-06-01 www.ifvgroup.asia | 2022-06-01

Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.

Related screenshots
Screenshots of pages that talked to this domain

DNS recordsRetrieved via DNS ANY query

A 110.4.45.100 (TTL: 21600)
MX aspmx.l.google.com (Priority: 1)
MX alt4.aspmx.l.google.com (Priority: 10)
MX alt3.aspmx.l.google.com (Priority: 10)
MX alt1.aspmx.l.google.com (Priority: 5)
MX alt2.aspmx.l.google.com (Priority: 5)
NS ns134.mschosting.com
NS ns132.mschosting.com
NS ns131.mschosting.com
NS ns133.mschosting.com
TXT v=spf1 include:_spf.google.com ~all
SOA ns134.mschosting.com
hostmaster: daniel.ifvgroup.asia / serial: 2024101102 / refresh: 10800 / retry: 3600 / expire: 1209600 / minttl: 10800 /