himalayanwildlifesanctuary.com
AMAZON-02, US


Seen 10 times between January 22nd, 2021 and January 4th, 2025.


General Info Open in Search

Geo United States (US) —
AS AS16509 - AMAZON-02, US
Note: An IP might be announced by multiple ASs. This is not shown.
Route 3.33.128.0/17 (Route of ASN)
PTR a2aa9ff50de748dbe.awsglobalaccelerator.com(PTR record of primary IP)
IPv4 3.33.130.190  15.197.148.33 

Live Screenshot Hover to expand

Attention: This is a live snapshot of this website, we do not host or control it!

Incoming hits
Summary of pages that talked to this domain

ASNs AS209242 | 1x

IPs 45.194.53.13 | 1x

Domains www.lupesno2.com | 1x

Countries US | 1x

Recent scans (1 total) Show all

URL Age
www.lupesno2.com 4 months

Disclaimer

The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.

Recent screenshots
Screenshots of pages hosted on this domain

Related infrastructure
Summary of infrastructure which pages hosted on this domain frequently talked to

IPs 65.60.61.194 | 7x 3.33.130.190 | 1x 15.197.148.33 | 1x

Domains himalayanwildlifesanctuary.com | 8x www.himalayanwildlifesanctuary.com | 1x

Recently observed hostnames on 'himalayanwildlifesanctuary.com'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.

cpcalendars.himalayanwildlifesanctuary.com | 2020-05-01 cpcontacts.himalayanwildlifesanctuary.com | 2020-05-01 autodiscover.himalayanwildlifesanctuary.com | 2019-06-12 cpanel.himalayanwildlifesanctuary.com | 2019-06-12 himalayanwildlifesanctuary.com | 2019-06-12 mail.himalayanwildlifesanctuary.com | 2019-06-12 webdisk.himalayanwildlifesanctuary.com | 2019-06-12 webmail.himalayanwildlifesanctuary.com | 2019-06-12 www.himalayanwildlifesanctuary.com | 2019-06-12

Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.

Related screenshots
Screenshots of pages that talked to this domain

DNS recordsRetrieved via DNS ANY query

A 3.33.130.190 (TTL: 600)
A 15.197.148.33 (TTL: 600)
NS ns29.domaincontrol.com
NS ns30.domaincontrol.com
SOA ns29.domaincontrol.com
hostmaster: dns.jomax.net / serial: 2024102305 / refresh: 28800 / retry: 7200 / expire: 604800 / minttl: 600 /

WHOIS for himalayanwildlifesanctuary.com

Rate limit exceeded. Try again after: 24h0m0s