heydarikermanshahapp.sharifdana11.ir
DGPCO Dadeh Gostar Parmis PJS Company, IR
Seen 1 times between October 15th, 2024 and October 15th, 2024.
General Info Open in Search
Geo | Iran, Islamic Republic Of (IR) — |
Domain | sharifdana11.ir (The registered domain) |
AS | AS207125 - DGPCO Dadeh Gostar Parmis PJS Company, IR
Note: An IP might be announced by multiple ASs. This is not shown. |
Route | 185.165.116.0/22 (Route of ASN) |
PTR | av.wir5.32.maralhost.com(PTR record of primary IP) |
IPv4 | 185.165.116.32 |
Direct hits
Summary of pages hosted on this domain
IPs 185.165.116.32 | 1x
Domains heydarikermanshahapp.sharifdana11.ir | 1x
Recent scans (1 total) Show all
URL | Age | |||||
---|---|---|---|---|---|---|
heydarikermanshahapp.sharifdana11.ir | 2 months | 18 | 2 | 1 |
No incoming hits
Nothing talked to this domain
Disclaimer
The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.
Recent screenshots
Screenshots of pages hosted on this domain
Related infrastructure
Summary of infrastructure which pages hosted on this domain frequently talked to
IPs 185.165.116.32 | 1x
Domains heydarikermanshahapp.sharifdana11.ir | 1x
Recently observed hostnames on 'heydarikermanshahapp.sharifdana11.ir'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.
heydarikermanshahapp.sharifdana11.ir
| 2024-10-14
Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.
DNS recordsRetrieved via DNS ANY query
A |
185.165.116.32
(TTL: 21600)
|
WHOIS for heydarikermanshahapp.sharifdana11.ir
domain: sharifdana11.ir ascii: sharifdana11.ir remarks: The information about this domain is hidden by the domain holder nserver: wir5.maralhost.com nserver: wir6.maralhost.com source: IRNIC