freemarketingplan.lawfirmmarketingpros.com
AS-VULTR, US
Not observed on urlscan.io
General Info Open in Search
Geo | Dallas, Texas, United States (US) — |
Created | September 25th, 2019 |
Domain | lawfirmmarketingpros.com (The registered domain) |
AS | AS20473 - AS-VULTR, US
Note: An IP might be announced by multiple ASs. This is not shown. |
Route | 149.28.128.0/17 (Route of ASN) |
PTR | win10.ipaxes.com(PTR record of primary IP) |
IPv4 | 149.28.250.251 |
No direct hits
Nothing is hosted on this domain
No incoming hits
Nothing talked to this domain
Disclaimer
The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.
Recently observed hostnames on 'freemarketingplan.lawfirmmarketingpros.com'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.
freemarketingplan.lawfirmmarketingpros.com
| 2020-09-23
Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.
WHOIS for freemarketingplan.lawfirmmarketingpros.com
Domain Name: LAWFIRMMARKETINGPROS.COM Registry Domain ID: 2437286330_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.publicdomainregistry.com Registrar URL: www.publicdomainregistry.com Updated Date: 2024-09-22T14:58:01Z Creation Date: 2019-09-25T19:07:20Z Registrar Registration Expiration Date: 2025-09-25T19:07:20Z Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com Registrar IANA ID: 303 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Registry Registrant ID: Not Available From Registry Registrant Name: Joshua Konigsberg Registrant Organization: Registrant Street: 1811 Flower Dr Registrant City: Palm Beach Gardens Registrant State/Province: Florida Registrant Postal Code: 33410 Registrant Country: US Registrant Phone: +1.5612281450 Registrant Phone Ext: Registrant Fax: Registrant Fax Ext: Registrant Email: leaddog16@hotmail.com Registry Admin ID: Not Available From Registry Admin Name: Joshua Konigsberg Admin Organization: Admin Street: 1811 Flower Dr Admin City: Palm Beach Gardens Admin State/Province: Florida Admin Postal Code: 33410 Admin Country: US Admin Phone: +1.5612281450 Admin Phone Ext: Admin Fax: Admin Fax Ext: Admin Email: leaddog16@hotmail.com Registry Tech ID: Not Available From Registry Tech Name: Joshua Konigsberg Tech Organization: Tech Street: 1811 Flower Dr Tech City: Palm Beach Gardens Tech State/Province: Florida Tech Postal Code: 33410 Tech Country: US Tech Phone: +1.5612281450 Tech Phone Ext: Tech Fax: Tech Fax Ext: Tech Email: leaddog16@hotmail.com Name Server: naomi.ns.cloudflare.com Name Server: sid.ns.cloudflare.com DNSSEC: Unsigned Registrar Abuse Contact Email: abuse-contact@publicdomainregistry.com Registrar Abuse Contact Phone: +1.2013775952 URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2024-12-28T17:09:42Z <<< For more information on Whois status codes, please visit https://icann.org/epp Registration Service Provided By: The data in this whois database is provided to you for information purposes only, that is, to assist you in obtaining information about or related to a domain name registration record. We make this information available "as is", and do not guarantee its accuracy. By submitting a whois query, you agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to: (1) enable high volume, automated, electronic processes that stress or load this whois database system providing you this information; or (2) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via direct mail, electronic mail, or by telephone. The compilation, repackaging, dissemination or other use of this data is expressly prohibited without prior written consent from us. The Registrar of record is PDR Ltd. d/b/a PublicDomainRegistry.com. We reserve the right to modify these terms at any time. By submitting this query, you agree to abide by these terms.