avyagrapharma.digitalmediaplatform.com
AMAZON-02, US


Not observed on urlscan.io


General Info Open in Search

Geo Columbus, Ohio, United States (US) —
Created August 4th, 2016
Domain digitalmediaplatform.com (The registered domain)
AS AS16509 - AMAZON-02, US
Note: An IP might be announced by multiple ASs. This is not shown.
Route 3.128.0.0/12 (Route of ASN)
PTR ec2-3-130-204-160.us-east-2.compute.amazonaws.com(PTR record of primary IP)
IPv4 3.130.204.160  3.130.253.23 

Live Screenshot Hover to expand

Attention: This is a live snapshot of this website, we do not host or control it!

No direct hits
Nothing is hosted on this domain

No incoming hits
Nothing talked to this domain

Disclaimer

The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.

Recently observed hostnames on 'avyagrapharma.digitalmediaplatform.com'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.

avyagrapharma.digitalmediaplatform.com | 2020-05-16 www.avyagrapharma.digitalmediaplatform.com | 2020-05-16

Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.

DNS recordsRetrieved via DNS ANY query

CNAME traff-2.hugedomains.com

Registration information

Created August 4th, 2016
Updated July 8th, 2023
Registrar TurnCommerce, Inc. DBA NameBright.com

WHOIS for avyagrapharma.digitalmediaplatform.com

Domain Name: DIGITALMEDIAPLATFORM.COM
Registry Domain ID: 2049286580_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.NameBright.com
Registrar URL: https://www.NameBright.com
Updated Date: 2023-07-08T11:50:33.896Z
Creation Date: 2016-08-04T13:39:01.000Z
Registrar Registration Expiration Date: 2025-08-04T13:39:01.000Z
Registrar: TurnCommerce, Inc. DBA NameBright.com
Registrar IANA ID: 1441
Registrar Abuse Contact Email: abuse@NameBright.com
Registrar Abuse Contact Phone: +1.7204960020
Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Domain Admin / This Domain is For Sale
Registrant Organization: HugeDomains.com
Registrant Street: 2635 Walnut Street
Registrant City: Denver
Registrant State/Province: CO
Registrant Postal Code: 80205
Registrant Country: US
Registrant Phone: +1.3038930552
Registrant Phone Ext: 
Registrant Fax: 
Registrant Fax Ext: 
Registrant Email: domains@hugedomains.com
Registry Admin ID: Not Available From Registry
Admin Name: Domain Admin / This Domain is For Sale
Admin Organization: HugeDomains.com
Admin Street: 2635 Walnut Street
Admin City: Denver
Admin State/Province: CO
Admin Postal Code: 80205
Admin Country: US
Admin Phone: +1.3038930552
Admin Phone Ext: 
Admin Fax: 
Admin Fax Ext: 
Admin Email: domains@hugedomains.com
Registry Tech ID: Not Available From Registry
Tech Name: Domain Admin / This Domain is For Sale
Tech Organization: HugeDomains.com
Tech Street: 2635 Walnut Street
Tech City: Denver
Tech State/Province: CO
Tech Postal Code: 80205
Tech Country: US
Tech Phone: +1.3038930552
Tech Phone Ext: 
Tech Fax: 
Tech Fax Ext: 
Tech Email: domains@hugedomains.com
Name Server: NSG1.NAMEBRIGHTDNS.COM
Name Server: NSG2.NAMEBRIGHTDNS.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2023-07-08T11:50:33.896Z <<<