avyagrapharma.digitalmediaplatform.com
AMAZON-02, US
Not observed on urlscan.io
General Info Open in Search
Geo | Columbus, Ohio, United States (US) — |
Created | August 4th, 2016 |
Domain | digitalmediaplatform.com (The registered domain) |
AS | AS16509 - AMAZON-02, US
Note: An IP might be announced by multiple ASs. This is not shown. |
Route | 3.128.0.0/12 (Route of ASN) |
PTR | ec2-3-130-204-160.us-east-2.compute.amazonaws.com(PTR record of primary IP) |
IPv4 | 3.130.204.160 3.130.253.23 |
No direct hits
Nothing is hosted on this domain
No incoming hits
Nothing talked to this domain
Disclaimer
The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.
Recently observed hostnames on 'avyagrapharma.digitalmediaplatform.com'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.
avyagrapharma.digitalmediaplatform.com
| 2020-05-16
www.avyagrapharma.digitalmediaplatform.com
| 2020-05-16
Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.
Registration information
Created | August 4th, 2016 |
Updated | July 8th, 2023 |
Registrar | TurnCommerce, Inc. DBA NameBright.com |
WHOIS for avyagrapharma.digitalmediaplatform.com
Domain Name: DIGITALMEDIAPLATFORM.COM Registry Domain ID: 2049286580_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.NameBright.com Registrar URL: https://www.NameBright.com Updated Date: 2023-07-08T11:50:33.896Z Creation Date: 2016-08-04T13:39:01.000Z Registrar Registration Expiration Date: 2025-08-04T13:39:01.000Z Registrar: TurnCommerce, Inc. DBA NameBright.com Registrar IANA ID: 1441 Registrar Abuse Contact Email: abuse@NameBright.com Registrar Abuse Contact Phone: +1.7204960020 Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited Registry Registrant ID: Not Available From Registry Registrant Name: Domain Admin / This Domain is For Sale Registrant Organization: HugeDomains.com Registrant Street: 2635 Walnut Street Registrant City: Denver Registrant State/Province: CO Registrant Postal Code: 80205 Registrant Country: US Registrant Phone: +1.3038930552 Registrant Phone Ext: Registrant Fax: Registrant Fax Ext: Registrant Email: domains@hugedomains.com Registry Admin ID: Not Available From Registry Admin Name: Domain Admin / This Domain is For Sale Admin Organization: HugeDomains.com Admin Street: 2635 Walnut Street Admin City: Denver Admin State/Province: CO Admin Postal Code: 80205 Admin Country: US Admin Phone: +1.3038930552 Admin Phone Ext: Admin Fax: Admin Fax Ext: Admin Email: domains@hugedomains.com Registry Tech ID: Not Available From Registry Tech Name: Domain Admin / This Domain is For Sale Tech Organization: HugeDomains.com Tech Street: 2635 Walnut Street Tech City: Denver Tech State/Province: CO Tech Postal Code: 80205 Tech Country: US Tech Phone: +1.3038930552 Tech Phone Ext: Tech Fax: Tech Fax Ext: Tech Email: domains@hugedomains.com Name Server: NSG1.NAMEBRIGHTDNS.COM Name Server: NSG2.NAMEBRIGHTDNS.COM DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2023-07-08T11:50:33.896Z <<<