aqaonlypartner-zaqajenkmassmessagestestsrffflcyd.phxplat-tst.com


Seen 4 times between February 23rd, 2022 and February 23rd, 2022.


General Info Open in Search

Created May 15th, 2020
Domain phxplat-tst.com (The registered domain)

Live Screenshot Hover to expand

Attention: This is a live snapshot of this website, we do not host or control it!

No incoming hits
Nothing talked to this domain

Disclaimer

The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.

Recent screenshots
Screenshots of pages hosted on this domain

Related infrastructure
Summary of infrastructure which pages hosted on this domain frequently talked to

IPs 2606:4700::6812:9d3 | 4x

Domains aqaonlypartner-zaqajenkmassmessagestestsrffflcyd.phxplat-tst.com | 4x

Recently observed hostnames on 'aqaonlypartner-zaqajenkmassmessagestestsrffflcyd.phxplat-tst.com'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.

aqaonlypartner-zaqajenkmassmessagestestsrffflcyd.phxplat-tst.com | 2022-02-23

Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.

WHOIS for aqaonlypartner-zaqajenkmassmessagestestsrffflcyd.phxplat-tst.com

Domain Name: PHXPLAT-TST.COM 
Registry Domain ID: 2526351459_DOMAIN_COM-VRSN 
Registrar WHOIS Server: whois.name.com 
Registrar URL: http://www.name.com 
Updated Date: 2024-04-15T16:58:37Z 
Creation Date: 2020-05-15T07:45:47Z 
Registrar Registration Expiration Date: 2025-05-15T07:45:47Z 
Registrar: Name.com, Inc. 
Registrar IANA ID: 625 
Reseller:  
Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited 
Registry Registrant ID: Not Available From Registry 
Registrant Name: Redacted For Privacy 
Registrant Organization: Domain Protection Services, Inc. 
Registrant Street: PO Box 1769  
Registrant City: Denver 
Registrant State/Province: CO 
Registrant Postal Code: 80201 
Registrant Country: US 
Registrant Phone: +1.7208009072 
Registrant Fax: +1.7209758725 
Registrant Email: https://www.name.com/contact-domain-whois/phxplat-tst.com 
Registry Admin ID: Not Available From Registry 
Admin Name: Redacted For Privacy 
Admin Organization: Domain Protection Services, Inc. 
Admin Street: PO Box 1769  
Admin City: Denver 
Admin State/Province: CO 
Admin Postal Code: 80201 
Admin Country: US 
Admin Phone: +1.7208009072 
Admin Fax: +1.7209758725 
Admin Email: https://www.name.com/contact-domain-whois/phxplat-tst.com 
Registry Tech ID: Not Available From Registry 
Tech Name: Redacted For Privacy 
Tech Organization: Domain Protection Services, Inc. 
Tech Street: PO Box 1769  
Tech City: Denver 
Tech State/Province: CO 
Tech Postal Code: 80201 
Tech Country: US 
Tech Phone: +1.7208009072 
Tech Fax: +1.7209758725 
Tech Email: https://www.name.com/contact-domain-whois/phxplat-tst.com 
Name Server: west.ns.cloudflare.com 
Name Server: evangeline.ns.cloudflare.com 
DNSSEC: unSigned 
Registrar Abuse Contact Email: abuse@name.com 
Registrar Abuse Contact Phone: +1.7203101849 
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2024-11-22T23:13:47Z <<< 

For more information on Whois status codes, please visit https://icann.org/epp

The data in the Name.com, Inc. WHOIS database is provided by Name.com, Inc. for information purposes, and to assist persons in obtaining information about or related to a domain name registration record. Name.com, Inc. does not guarantee its accuracy.  Users accessing the Name.com, Inc. WHOIS service agree to use the data only for lawful purposes, and under no circumstances may this data be used to: a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the registrar's own existing customers and b) enable high volume, automated, electronic processes that send queries or data to the systems of Name.com, Inc., except as reasonably necessary to register domain names or modify existing registrations. When using the Name.com, Inc. WHOIS service, please consider the following: the WHOIS service is not a replacement for standard EPP commands to the SRS service. WHOIS is not considered authoritative for registered domain objects. The WHOIS service may be scheduled for downtime during production or OT&E maintenance periods. Where applicable, the presence of a [Non-Public Data] tag indicates that such data is not made publicly available due to applicable data privacy laws or requirements.  Access to non-public data may be provided, upon request, where it can be reasonably confirmed that the requester holds a specific legitimate interest and a proper legal basis, for accessing the withheld data. Access to this data can be requested by submitting a request via the form found at https://www.name.com/layered-access-request . Name.com, Inc. reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.