apluschimneysweepfireplacerepair.com
AS-HOSTINGER Hostinger International Limited, CY
Seen 1 times between October 21st, 2024 and October 21st, 2024.
General Info Open in Search
Geo | Phoenix, Arizona, United States (US) — |
AS | AS47583 - AS-HOSTINGER Hostinger International Limited, CY
Note: An IP might be announced by multiple ASs. This is not shown. |
Route | 77.37.88.0/21 (Route of ASN) |
IPv4 | 77.37.90.194 |
IPv6 | 2a02:4780:b:1519:0:1367:7fa7:10 |
Direct hits
Summary of pages hosted on this domain
IPs 2a02:4780:b:1519:0:1367:7fa7:10 | 1x
Domains apluschimneysweepfireplacerepair.com | 1x
Recent scans (1 total) Show all
URL | Age | |||||
---|---|---|---|---|---|---|
apluschimneysweepfireplacerepair.com/chimney-cleaning/ | a month | 45 | 5 | 2 |
No incoming hits
Nothing talked to this domain
Disclaimer
The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.
Recent screenshots
Screenshots of pages hosted on this domain
Related infrastructure
Summary of infrastructure which pages hosted on this domain frequently talked to
IPs 2a02:4780:b:1519:0:1367:7fa7:10 | 1x
Domains apluschimneysweepfireplacerepair.com | 1x
Recently observed hostnames on 'apluschimneysweepfireplacerepair.com'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.
www.apluschimneysweepfireplacerepair.com
| 2024-03-05
apluschimneysweepfireplacerepair.com
| 2024-03-05
Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.
WHOIS for apluschimneysweepfireplacerepair.com
Excessive querying