4safelinkpaypalredirectmailservices.newbillinginfo.us
PLI-AS Private Layer INC, PA


Seen 1 times between March 16th, 2020 and March 16th, 2020.


General Info Open in Search

Geo Zurich, Switzerland (CH) —
Domain newbillinginfo.us (The registered domain)
AS AS51852 - PLI-AS Private Layer INC, PA
Note: An IP might be announced by multiple ASs. This is not shown.
Route 81.17.16.0/20 (Route of ASN)
PTR hostedby.privatelayer.com(PTR record of primary IP)
IPv4 81.17.29.146 

Live Screenshot Hover to expand

Attention: This is a live snapshot of this website, we do not host or control it!

Direct hits
Summary of pages hosted on this domain

Domains 4safelinkpaypalredirectmailservices.newbillinginfo.us | 1x

Recent scans (1 total) Show all

URL Age
4safelinkpaypalredirectmailservices.newbillinginfo.us 5 years

No incoming hits
Nothing talked to this domain

Disclaimer

The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.

Recent screenshots
Screenshots of pages hosted on this domain

Related infrastructure
Summary of infrastructure which pages hosted on this domain frequently talked to

Domains 4safelinkpaypalredirectmailservices.newbillinginfo.us | 1x

DNS recordsRetrieved via DNS ANY query

A 81.17.18.194 (TTL: 600)