4safelinkpaypalredirectmailservices.newbillinginfo.us
PLI-AS Private Layer INC, PA
Seen 1 times between March 16th, 2020 and March 16th, 2020.
General Info Open in Search
Geo | Zurich, Switzerland (CH) — |
Domain | newbillinginfo.us (The registered domain) |
AS | AS51852 - PLI-AS Private Layer INC, PA
Note: An IP might be announced by multiple ASs. This is not shown. |
Route | 81.17.16.0/20 (Route of ASN) |
PTR | hostedby.privatelayer.com(PTR record of primary IP) |
IPv4 | 81.17.29.146 |
Direct hits
Summary of pages hosted on this domain
Domains 4safelinkpaypalredirectmailservices.newbillinginfo.us | 1x
Recent scans (1 total) Show all
URL | Age | |||||
---|---|---|---|---|---|---|
4safelinkpaypalredirectmailservices.newbillinginfo.us | 5 years | 2 | 1 | 0 |
No incoming hits
Nothing talked to this domain
Disclaimer
The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.
Recent screenshots
Screenshots of pages hosted on this domain
Related infrastructure
Summary of infrastructure which pages hosted on this domain frequently talked to
Domains 4safelinkpaypalredirectmailservices.newbillinginfo.us | 1x
DNS recordsRetrieved via DNS ANY query
A |
81.17.18.194
(TTL: 600)
|