store.chilichichi.com
Open in
urlscan Pro
54.154.42.22
Public Scan
URL:
https://store.chilichichi.com/
Submission: On December 19 via api from US — Scanned from US
Submission: On December 19 via api from US — Scanned from US
Form analysis
1 forms found in the DOMGET http://store.chilichichi.com/index.aspx?pageid=GLXLJ
<form action="http://store.chilichichi.com/index.aspx?pageid=GLXLJ" method="get"><input name="pageid" id="pageid" type="hidden" value="GLXLJ"><input name="chainID" id="chainID" type="hidden" value="910328">
<div class="search" data-editor-type="search">
<input type="text" aria-label="search" placeholder="product search..." id="txtQuickSearch" name="txtQuickSearch">
<button type="submit" aria-label="Submit search"><i class="fa fa-search"></i></button>
</div>
</form>
Text Content
Cookie Policy Chilichichi uses cookies to ensure you get the best experience on our website. DeclineAllow cookies English France USD AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL Menu HomeCartOffersContact Sign In $0.00 Home LeatherClothesWinter ClothesPulloverUnisexMenWomen * * * Welcome to our new online shop & magazine! And thanks for choosing Chilichichi! You can edit this text area however you want. Just login to your Control Panel and visit the Manage > Pages section. Grace leather Jacket View Details New Products Grace leather Jacket $306.13 View Details Skirt Nina 0501-Black $238.04 View Details Made Blanks Holiday Polar Fleece Pullo.. $21.00 View Details Featured Products Grace leather Jacket $306.13 View Details Rue Madame Shirt $95.55 View Details Made Blanks Holiday Pol.. $21.00 View Details Special Offers Grace leather Jacket $306.13 View Details BEAUTY AWARD 2023 IF YOU’RE FEELING OVERWHELMED by the sheer volume of beauty products on store shelves, you’re not alone. Read on for this year’s award winners. Pages HomeCartOffersContactSign In Store Links About keep me informed Sign Up for our Newsletter Subscribe search © 2023. ⎖CHILICHICHI | ie9+ | PayPal store TermsPrivacySitemap MODAL DIALOG TITLE Modal Dialog Content Cancel Ok Create a free online store Powered by freewebstore.com Get your free online store today - Be your own boss! freewebstore Got a great business idea? Get a free online store just like this one! What do I get? Fully loaded webstore Unlimited products Domain & SSL checkout 24/7 support And more... Why freewebstore? 15+ years 1 million stores created No card required Easy to create What's the catch? Nope, no catch 0% commission Free forever! Premium upgrades available Get Started i ? Shopify Alternative - click here freewebstore