www.vedanshbuildingmaterial.in Open in urlscan Pro
103.20.127.61  Public Scan

2 Outgoing links

These are links going to different origins than the main page.

Search URL Search Domain Scan URL

---

Search URL Search Domain Scan URL

---

Redirected requests

There were HTTP redirect chains for the following requests:

44 HTTP transactions Everything HTML Script AJAX CSS Image Expand all
3 data transactions

Method Protocol	Status	Resource Path	Size x-fer	Time Latency	Type MIME-Type	IP Location
GET H/1.1	200 OK	Primary Request / Show response www.vedanshbuildingmaterial.in/	155 KB 27 KB	2162ms 780ms	Document text/html	103.20.127.61 JUSTDIAL-AS-IN Pa...
General Check archive.org Show headers Download Go to Full URL https://www.vedanshbuildingmaterial.in/ Protocol HTTP/1.1 Security TLS 1.2, ECDHE_RSA, AES_256_GCM Server 103.20.127.61 , India, ASN132415 (JUSTDIAL-AS-IN Palm Court Bldg M, 501B, 5th Floor, New Link Road, IN), Reverse DNS Software nginx / Express Resource Hash 0f0b80754dec04068ea88c7d6d039c79df2ed1bf9c3b50438508f5bb99ddb7d6 Security Headers Name Value Content-Security-Policy frame-ancestors 'none'; X-Frame-Options sameorigin Request headers Upgrade-Insecure-Requests 1 User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 accept-language en-US,en;q=0.9 Response headers Access-Control-Allow-Origin http://gammatesting.jdseller.com Cache-Control no-cache, no-store, must-revalidate, no-transform Content-Encoding gzip Content-Security-Policy frame-ancestors 'none'; Content-Type text/html; charset=utf-8 Date Wed, 10 Jan 2024 19:34:25 GMT ETag W/"26b4b-eoqRGGYTHgt4dtU9tcPTLtIuVls" Expires 0 Pragma no-cache Server nginx Transfer-Encoding chunked Vary Accept-Encoding X-Frame-Options sameorigin X-Powered-By Express
GET H2	200	22579.5b2c44a3.css static1.jdomni.in/mpstatic/webstore/css/	464 KB 87 KB	346ms 93ms	Stylesheet text/css	2600:1408:ac00:28f::174d AKAMAI-ASN1
General Check archive.org Show headers Download Go to Full URL https://static1.jdomni.in/mpstatic/webstore/css/22579.5b2c44a3.css Requested by Host: www.vedanshbuildingmaterial.in URL: https://www.vedanshbuildingmaterial.in/ Protocol H2 Security TLS 1.3, , AES_256_GCM Server 2600:1408:ac00:28f::174d Ashburn, United States, ASN20940 (AKAMAI-ASN1, NL), Reverse DNS Software nginx / Express Resource Hash 8d7ff5eb0f561fb59fe1c974500bc2f4e64eeb4090facac97ccce3447a834a0d Request headers accept-language en-US,en;q=0.9 Referer https://www.vedanshbuildingmaterial.in/ User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers date Wed, 10 Jan 2024 19:34:26 GMT content-encoding gzip last-modified Wed, 25 Oct 2023 13:16:44 GMT server nginx x-powered-by Express etag W/"7415a-18b66faf260" vary Accept-Encoding content-type text/css; charset=UTF-8 access-control-allow-origin * cache-control public, max-age=29155968 content-length 88831 expires Fri, 13 Dec 2024 06:27:14 GMT
GET H2	200	25926.ea41e687.css static1.jdomni.in/mpstatic/webstore/css/	13 KB 3 KB	286ms 33ms	Stylesheet text/css	2600:1408:ac00:28f::174d AKAMAI-ASN1
General Check archive.org Show headers Download Go to Full URL https://static1.jdomni.in/mpstatic/webstore/css/25926.ea41e687.css Requested by Host: www.vedanshbuildingmaterial.in URL: https://www.vedanshbuildingmaterial.in/ Protocol H2 Security TLS 1.3, , AES_256_GCM Server 2600:1408:ac00:28f::174d Ashburn, United States, ASN20940 (AKAMAI-ASN1, NL), Reverse DNS Software nginx / Express Resource Hash f62304bbaa1e95e93a11203b745dc54bf916e0a6d8c61a7f841e2c440a520943 Request headers accept-language en-US,en;q=0.9 Referer https://www.vedanshbuildingmaterial.in/ User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers date Wed, 10 Jan 2024 19:34:26 GMT content-encoding gzip last-modified Thu, 09 Jun 2022 09:44:04 GMT server nginx x-powered-by Express etag W/"3204-18147d97aa0" vary Accept-Encoding content-type text/css; charset=UTF-8 access-control-allow-origin * cache-control public, max-age=30708322 content-length 2968 expires Tue, 31 Dec 2024 05:39:48 GMT
GET H2	200	77048.73c41c08.css static1.jdomni.in/mpstatic/webstore/css/	38 KB 7 KB	353ms 100ms	Stylesheet text/css	2600:1408:ac00:28f::174d AKAMAI-ASN1
General Check archive.org Show headers Download Go to Full URL https://static1.jdomni.in/mpstatic/webstore/css/77048.73c41c08.css Requested by Host: www.vedanshbuildingmaterial.in URL: https://www.vedanshbuildingmaterial.in/ Protocol H2 Security TLS 1.3, , AES_256_GCM Server 2600:1408:ac00:28f::174d Ashburn, United States, ASN20940 (AKAMAI-ASN1, NL), Reverse DNS Software nginx / Express Resource Hash 0e78160f3f3afabad93c36a10c5397b29ecd7a8a4ba89ba68aefe11c1a565f86 Request headers accept-language en-US,en;q=0.9 Referer https://www.vedanshbuildingmaterial.in/ User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers date Wed, 10 Jan 2024 19:34:26 GMT content-encoding gzip last-modified Tue, 28 Mar 2023 10:21:19 GMT server nginx x-powered-by Express etag W/"96f3-18727bc8518" vary Accept-Encoding content-type text/css; charset=UTF-8 access-control-allow-origin * cache-control public, max-age=29654874 content-length 7107 expires Thu, 19 Dec 2024 01:02:20 GMT
GET H2	200	91384.2355c8ff.css static1.jdomni.in/mpstatic/webstore/css/	20 KB 4 KB	284ms 32ms	Stylesheet text/css	2600:1408:ac00:28f::174d AKAMAI-ASN1
General Check archive.org Show headers Download Go to Full URL https://static1.jdomni.in/mpstatic/webstore/css/91384.2355c8ff.css Requested by Host: www.vedanshbuildingmaterial.in URL: https://www.vedanshbuildingmaterial.in/ Protocol H2 Security TLS 1.3, , AES_256_GCM Server 2600:1408:ac00:28f::174d Ashburn, United States, ASN20940 (AKAMAI-ASN1, NL), Reverse DNS Software nginx / Express Resource Hash 529f6d85e9907b0185995ae9593d9e41db0cdf318cf230a6c3ddee55108fe27e Request headers accept-language en-US,en;q=0.9 Referer https://www.vedanshbuildingmaterial.in/ User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers date Wed, 10 Jan 2024 19:34:26 GMT content-encoding gzip last-modified Mon, 29 May 2023 14:29:24 GMT server nginx x-powered-by Express etag W/"4f96-18867e9eda0" vary Accept-Encoding content-type text/css; charset=UTF-8 access-control-allow-origin * cache-control public, max-age=29019607 content-length 3965 expires Wed, 11 Dec 2024 16:34:33 GMT
GET H2	200	contentblock.css static3.jdomni.in/mpstatic/webstore/	63 KB 11 KB	452ms 185ms	Stylesheet text/css	2600:1408:ec00:681::174d AKAMAI-ASN1
General Check archive.org Show headers Download Go to Full URL https://static3.jdomni.in/mpstatic/webstore/contentblock.css?q=static-layouts/template80,featureProduct,static-layouts/template1,gallery/gallery,video/jd-dynamic-video,testimonial/pepperFryTestimonial,static-layouts/map-with-contact,static-layouts/template90,static-layouts/notification&themeVersion=1701354612000&ver=4a5ebc191a07cafa0b1a Requested by Host: www.vedanshbuildingmaterial.in URL: https://www.vedanshbuildingmaterial.in/ Protocol H2 Security TLS 1.3, , AES_256_GCM Server 2600:1408:ec00:681::174d Ashburn, United States, ASN20940 (AKAMAI-ASN1, NL), Reverse DNS Software nginx / Express Resource Hash 44002f95f0db970abc51c262e1250a1402e6b265c430f7405b406912455e51cd Request headers accept-language en-US,en;q=0.9 Referer https://www.vedanshbuildingmaterial.in/ User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers date Wed, 10 Jan 2024 19:34:26 GMT content-encoding gzip server nginx x-powered-by Express etag W/"fbc5-QuC+nhpcU5Ij47yixSN+hUKbSKg" vary Accept-Encoding content-type text/css; charset=utf-8 access-control-allow-origin * cache-control max-age=31536000 content-length 10588 expires Thu, 09 Jan 2025 19:34:26 GMT
GET DATA	200 OK	truncated /	360 B 0		Image image/svg+xml
General Check archive.org Show headers Download Go to Show image Full URL data:truncated Protocol DATA Server -, , ASN (), Reverse DNS Software / Resource Hash b8344c86cce97f95bbeff069bc7a6935498ccf472b9bea73f80547a06919bcb8 Request headers accept-language en-US,en;q=0.9 Referer User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers Content-Type image/svg+xml
GET DATA	200 OK	truncated /	26 B 0		Image image/gif
General Check archive.org Show headers Download Go to Show image Full URL data:truncated Protocol DATA Server -, , ASN (), Reverse DNS Software / Resource Hash 3b7b8a4b411ddf8db9bacc2f3aabf406f8e4c0c087829b336ca331c40adfdff1 Request headers accept-language en-US,en;q=0.9 Referer User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers Content-Type image/gif
GET H2	200	53F22B872409ACD5971476EF7E_1657178306099.jpg image3.jdomni.in/banner/07072022/FF/D7/EA/	52 KB 52 KB	330ms 76ms	Image image/webp	2600:1408:5400:4b1::174d AKAMAI-ASN1
General Check archive.org Show headers Download Go to Show image Full URL https://image3.jdomni.in/banner/07072022/FF/D7/EA/53F22B872409ACD5971476EF7E_1657178306099.jpg?output-format=webp Requested by Host: www.vedanshbuildingmaterial.in URL: https://www.vedanshbuildingmaterial.in/ Protocol H2 Security TLS 1.3, , AES_256_GCM Server 2600:1408:5400:4b1::174d Ashburn, United States, ASN20940 (AKAMAI-ASN1, NL), Reverse DNS Software Akamai Image Manager / Resource Hash 87df4054813886ea249631a38044684e269175a1fd984df4af320c1e32ef2625 Request headers accept-language en-US,en;q=0.9 Referer https://www.vedanshbuildingmaterial.in/ User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers date Wed, 10 Jan 2024 19:34:26 GMT last-modified Tue, 21 Nov 2023 11:10:20 GMT x-serial 1180 server Akamai Image Manager x-check-cacheable YES etag "079bccd99f611e1bb475c9d059e9803e" content-type image/webp access-control-allow-origin * cache-control private, no-transform, max-age=29929516 content-length 52804 expires Sun, 22 Dec 2024 05:19:42 GMT
GET H2	200	AE3CAFFAAB2AC1ED83B56C12A3_1657178398473.jpg image3.jdomni.in/banner/07072022/43/CA/32/	95 KB 95 KB	477ms 223ms	Image image/webp	2600:1408:5400:4b1::174d AKAMAI-ASN1
General Check archive.org Show headers Download Go to Show image Full URL https://image3.jdomni.in/banner/07072022/43/CA/32/AE3CAFFAAB2AC1ED83B56C12A3_1657178398473.jpg?output-format=webp Requested by Host: www.vedanshbuildingmaterial.in URL: https://www.vedanshbuildingmaterial.in/ Protocol H2 Security TLS 1.3, , AES_256_GCM Server 2600:1408:5400:4b1::174d Ashburn, United States, ASN20940 (AKAMAI-ASN1, NL), Reverse DNS Software Akamai Image Manager / Resource Hash 9c30dc1cd5ecf2443f97a1e7682d96a0166aebc833fe1a342443a0cff192740e Request headers accept-language en-US,en;q=0.9 Referer https://www.vedanshbuildingmaterial.in/ User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers date Wed, 10 Jan 2024 19:34:26 GMT last-modified Thu, 21 Jul 2022 13:50:55 GMT x-serial 524 server Akamai Image Manager x-check-cacheable YES etag "837c4263bc6695ad0fbc882fbb619ee2" content-type image/webp access-control-allow-origin * cache-control private, no-transform, max-age=31480622 content-length 97128 expires Thu, 09 Jan 2025 04:11:28 GMT
GET H2	200	ADBEC4FE8EF8CBF297361DBBA7_1657178441478.png image2.jdomni.in/banner/07072022/E4/0D/DF/	143 KB 143 KB	477ms 224ms	Image image/jpeg	2600:1408:ec00:686::174d AKAMAI-ASN1
General Check archive.org Show headers Download Go to Show image Full URL https://image2.jdomni.in/banner/07072022/E4/0D/DF/ADBEC4FE8EF8CBF297361DBBA7_1657178441478.png?output-format=webp Requested by Host: www.vedanshbuildingmaterial.in URL: https://www.vedanshbuildingmaterial.in/ Protocol H2 Security TLS 1.3, , AES_256_GCM Server 2600:1408:ec00:686::174d Ashburn, United States, ASN20940 (AKAMAI-ASN1, NL), Reverse DNS Software Akamai Image Manager / Resource Hash 5bc4c988c4fc240def7c37f9862decb1174fd39d7a743b53663fbb268edd283c Request headers accept-language en-US,en;q=0.9 Referer https://www.vedanshbuildingmaterial.in/ User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers date Wed, 10 Jan 2024 19:34:26 GMT last-modified Thu, 21 Jul 2022 13:50:56 GMT server Akamai Image Manager etag "e0b6e6001b1fe8984b12ebf8b5bf3296" content-type image/jpeg access-control-allow-origin * cache-control private, no-transform, max-age=31133252 content-length 146202 expires Sun, 05 Jan 2025 03:41:58 GMT
GET H2	200	F02752DB066C67192C728DEA92_1657178633494.jpg image3.jdomni.in/banner/07072022/10/D2/DB/	43 KB 43 KB	493ms 240ms	Image image/webp	2600:1408:5400:4b1::174d AKAMAI-ASN1
General Check archive.org Show headers Download Go to Show image Full URL https://image3.jdomni.in/banner/07072022/10/D2/DB/F02752DB066C67192C728DEA92_1657178633494.jpg?output-format=webp Requested by Host: www.vedanshbuildingmaterial.in URL: https://www.vedanshbuildingmaterial.in/ Protocol H2 Security TLS 1.3, , AES_256_GCM Server 2600:1408:5400:4b1::174d Ashburn, United States, ASN20940 (AKAMAI-ASN1, NL), Reverse DNS Software Akamai Image Manager / Resource Hash 42cc451c640257d1c8c3d5bc8e7af432148237a9d00deb9b12637705121196ef Request headers accept-language en-US,en;q=0.9 Referer https://www.vedanshbuildingmaterial.in/ User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers date Wed, 10 Jan 2024 19:34:26 GMT last-modified Tue, 21 Nov 2023 11:10:23 GMT server Akamai Image Manager etag "dbc5a2d5b8c7db2dc3077d40080277d2" content-type image/webp access-control-allow-origin * cache-control private, no-transform, max-age=30178652 content-length 43882 expires Wed, 25 Dec 2024 02:31:58 GMT
GET H2	200	3808D2E183866938A4DF32BA69_1657178662651.jpg image3.jdomni.in/banner/07072022/AC/FD/69/	66 KB 66 KB	330ms 77ms	Image image/webp	2600:1408:5400:4b1::174d AKAMAI-ASN1
General Check archive.org Show headers Download Go to Show image Full URL https://image3.jdomni.in/banner/07072022/AC/FD/69/3808D2E183866938A4DF32BA69_1657178662651.jpg?output-format=webp Requested by Host: www.vedanshbuildingmaterial.in URL: https://www.vedanshbuildingmaterial.in/ Protocol H2 Security TLS 1.3, , AES_256_GCM Server 2600:1408:5400:4b1::174d Ashburn, United States, ASN20940 (AKAMAI-ASN1, NL), Reverse DNS Software Akamai Image Manager / Resource Hash 17cf84882bb2c00c4000858e45d312a3cf02e7fc4ee2b36e975ad35883693ffe Request headers accept-language en-US,en;q=0.9 Referer https://www.vedanshbuildingmaterial.in/ User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers date Wed, 10 Jan 2024 19:34:26 GMT last-modified Tue, 21 Nov 2023 11:10:23 GMT server Akamai Image Manager etag "051c6acdc646d80b50112e8d263f8c24" content-type image/webp access-control-allow-origin * cache-control private, no-transform, max-age=31525944 content-length 67146 expires Thu, 09 Jan 2025 16:46:50 GMT
GET H2	200	A6567E506766F8A1D34C1747F9_1657178691777.jpg image2.jdomni.in/banner/07072022/60/E2/21/	40 KB 40 KB	438ms 185ms	Image image/webp	2600:1408:ec00:686::174d AKAMAI-ASN1
General Check archive.org Show headers Download Go to Show image Full URL https://image2.jdomni.in/banner/07072022/60/E2/21/A6567E506766F8A1D34C1747F9_1657178691777.jpg?output-format=webp Requested by Host: www.vedanshbuildingmaterial.in URL: https://www.vedanshbuildingmaterial.in/ Protocol H2 Security TLS 1.3, , AES_256_GCM Server 2600:1408:ec00:686::174d Ashburn, United States, ASN20940 (AKAMAI-ASN1, NL), Reverse DNS Software Akamai Image Manager / Resource Hash c581a1b740e197f3e4d18f24b337e2a30120df0f8b81a3bf96c340301c68bb61 Request headers accept-language en-US,en;q=0.9 Referer https://www.vedanshbuildingmaterial.in/ User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers date Wed, 10 Jan 2024 19:34:26 GMT last-modified Wed, 27 Jul 2022 07:39:28 GMT server Akamai Image Manager etag "506908c71842f2765a7592befa9f6055" content-type image/webp access-control-allow-origin * cache-control private, no-transform, max-age=29475564 content-length 40496 expires Mon, 16 Dec 2024 23:13:50 GMT
GET H2	200	whatsapp_popup_2011271203.png image1.jdomni.in/jdomni_email/	725 B 920 B	317ms 66ms	Image image/png	2600:1408:ec00:681::174d AKAMAI-ASN1
General Check archive.org Show headers Download Go to Show image Full URL https://image1.jdomni.in/jdomni_email/whatsapp_popup_2011271203.png?output-format=webp Requested by Host: www.vedanshbuildingmaterial.in URL: https://www.vedanshbuildingmaterial.in/ Protocol H2 Security TLS 1.3, , AES_256_GCM Server 2600:1408:ec00:681::174d Ashburn, United States, ASN20940 (AKAMAI-ASN1, NL), Reverse DNS Software Akamai Image Manager / Resource Hash 85259cf485ba135ed431b8c20b56893dab927bcfb7e635292bb79dab6050c556 Request headers accept-language en-US,en;q=0.9 Referer https://www.vedanshbuildingmaterial.in/ User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers date Wed, 10 Jan 2024 19:34:26 GMT last-modified Thu, 21 Jul 2022 10:34:20 GMT server Akamai Image Manager etag "fb233719ba626beff4d9555319c66259" content-type image/png access-control-allow-origin * cache-control private, no-transform, max-age=26128177 content-length 725 expires Fri, 08 Nov 2024 05:24:03 GMT
GET H2	200	jquery.min.js Show response static3.jdomni.in/mpstatic/jd-angular/client/scripts/libs/jquery/	91 KB 32 KB	294ms 32ms	Script application/javascript	2600:1408:ec00:681::174d AKAMAI-ASN1
General Check archive.org Show headers Download Go to Full URL https://static3.jdomni.in/mpstatic/jd-angular/client/scripts/libs/jquery/jquery.min.js Requested by Host: www.vedanshbuildingmaterial.in URL: https://www.vedanshbuildingmaterial.in/ Protocol H2 Security TLS 1.3, , AES_256_GCM Server 2600:1408:ec00:681::174d Ashburn, United States, ASN20940 (AKAMAI-ASN1, NL), Reverse DNS Software nginx / Express Resource Hash fde6b2edf40fa734b0534c5df2e42f61476bd5a2321a6f9409e9b9191aaebcf5 Request headers Referer https://www.vedanshbuildingmaterial.in/ Origin https://www.vedanshbuildingmaterial.in accept-language en-US,en;q=0.9 User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers date Wed, 10 Jan 2024 19:34:26 GMT content-encoding gzip last-modified Mon, 19 Sep 2022 12:43:09 GMT server nginx x-powered-by Express etag W/"16b11-18355c61748" vary Accept-Encoding content-type application/javascript; charset=UTF-8 access-control-allow-origin * cache-control public, max-age=25442462 content-length 32772 expires Thu, 31 Oct 2024 06:55:28 GMT
GET H2	200	compatibilityWrapper.js Show response static3.jdomni.in/mpstatic/jd-angular/client/scripts/common/	15 KB 5 KB	293ms 31ms	Script application/javascript	2600:1408:ec00:681::174d AKAMAI-ASN1
General Check archive.org Show headers Download Go to Full URL https://static3.jdomni.in/mpstatic/jd-angular/client/scripts/common/compatibilityWrapper.js?ver=undefined Requested by Host: www.vedanshbuildingmaterial.in URL: https://www.vedanshbuildingmaterial.in/ Protocol H2 Security TLS 1.3, , AES_256_GCM Server 2600:1408:ec00:681::174d Ashburn, United States, ASN20940 (AKAMAI-ASN1, NL), Reverse DNS Software nginx / Express Resource Hash 6933e9cecaebbed2290da8768dea88ac60bb6115bb7eefe70f08f9cc902d0463 Request headers Referer https://www.vedanshbuildingmaterial.in/ Origin https://www.vedanshbuildingmaterial.in accept-language en-US,en;q=0.9 User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers date Wed, 10 Jan 2024 19:34:26 GMT content-encoding gzip last-modified Mon, 19 Sep 2022 12:43:09 GMT server nginx x-powered-by Express etag W/"3c3e-18355c61748" vary Accept-Encoding content-type application/javascript; charset=UTF-8 access-control-allow-origin * cache-control public, max-age=25902028 content-length 5070 expires Tue, 05 Nov 2024 14:34:54 GMT
GET H2	200	85758.4936a74c.js Show response static1.jdomni.in/mpstatic/webstore/	22 KB 11 KB	379ms 133ms	Script application/javascript	2600:1408:ac00:28f::174d AKAMAI-ASN1
General Check archive.org Show headers Download Go to Full URL https://static1.jdomni.in/mpstatic/webstore/85758.4936a74c.js Requested by Host: www.vedanshbuildingmaterial.in URL: https://www.vedanshbuildingmaterial.in/ Protocol H2 Security TLS 1.3, , AES_256_GCM Server 2600:1408:ac00:28f::174d Ashburn, United States, ASN20940 (AKAMAI-ASN1, NL), Reverse DNS Software nginx / Express Resource Hash d44a9e40fef806f42045055e877ffea8c9467bd678ec927a5ffb60d5a38e98a1 Request headers accept-language en-US,en;q=0.9 Referer https://www.vedanshbuildingmaterial.in/ User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers date Wed, 10 Jan 2024 19:34:26 GMT content-encoding gzip last-modified Mon, 08 Jan 2024 13:55:03 GMT server nginx x-powered-by Express etag W/"570e-18ce95afad8" vary Accept-Encoding content-type application/javascript; charset=UTF-8 access-control-allow-origin * cache-control public, max-age=31343309 content-length 11090 expires Tue, 07 Jan 2025 14:02:55 GMT
GET H2	200	75514.3a0762f1.js Show response static1.jdomni.in/mpstatic/webstore/	174 KB 54 KB	280ms 34ms	Script application/javascript	2600:1408:ac00:28f::174d AKAMAI-ASN1
General Check archive.org Show headers Download Go to Full URL https://static1.jdomni.in/mpstatic/webstore/75514.3a0762f1.js Requested by Host: www.vedanshbuildingmaterial.in URL: https://www.vedanshbuildingmaterial.in/ Protocol H2 Security TLS 1.3, , AES_256_GCM Server 2600:1408:ac00:28f::174d Ashburn, United States, ASN20940 (AKAMAI-ASN1, NL), Reverse DNS Software nginx / Express Resource Hash 0aa2b85fec50be563f55b281944357115c87bac2758d7453fadd4db554e6eb0a Request headers accept-language en-US,en;q=0.9 Referer https://www.vedanshbuildingmaterial.in/ User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers date Wed, 10 Jan 2024 19:34:26 GMT content-encoding gzip last-modified Thu, 29 Apr 2021 15:47:42 GMT server nginx x-powered-by Express etag W/"2b879-1791e507d30" vary Accept-Encoding content-type application/javascript; charset=UTF-8 access-control-allow-origin * cache-control public, max-age=28891849 content-length 55149 expires Tue, 10 Dec 2024 05:05:15 GMT
GET H2	200	22579.a82ca55d.js Show response static1.jdomni.in/mpstatic/webstore/	1 MB 331 KB	119ms 117ms	Script application/javascript	2600:1408:ac00:28f::174d AKAMAI-ASN1
General Check archive.org Show headers Download Go to Full URL https://static1.jdomni.in/mpstatic/webstore/22579.a82ca55d.js Requested by Host: www.vedanshbuildingmaterial.in URL: https://www.vedanshbuildingmaterial.in/ Protocol H2 Security TLS 1.3, , AES_256_GCM Server 2600:1408:ac00:28f::174d Ashburn, United States, ASN20940 (AKAMAI-ASN1, NL), Reverse DNS Software nginx / Express Resource Hash 76c59739c6f3396ceffc98fa85b9795ad3e7d1b424ef1b8d151ce75185970be3 Request headers accept-language en-US,en;q=0.9 Referer https://www.vedanshbuildingmaterial.in/ User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers date Wed, 10 Jan 2024 19:34:26 GMT content-encoding gzip last-modified Mon, 08 Jan 2024 13:55:04 GMT server nginx x-powered-by Express etag W/"138873-18ce95afec0" vary Accept-Encoding content-type application/javascript; charset=UTF-8 access-control-allow-origin * cache-control public, max-age=31343359 content-length 338375 expires Tue, 07 Jan 2025 14:03:45 GMT
GET H2	200	38184.2ed854d7.js Show response static1.jdomni.in/mpstatic/webstore/	71 KB 21 KB	103ms 101ms	Script application/javascript	2600:1408:ac00:28f::174d AKAMAI-ASN1
General Check archive.org Show headers Download Go to Full URL https://static1.jdomni.in/mpstatic/webstore/38184.2ed854d7.js Requested by Host: www.vedanshbuildingmaterial.in URL: https://www.vedanshbuildingmaterial.in/ Protocol H2 Security TLS 1.3, , AES_256_GCM Server 2600:1408:ac00:28f::174d Ashburn, United States, ASN20940 (AKAMAI-ASN1, NL), Reverse DNS Software nginx / Express Resource Hash e21ca297f06209f10e0316db7881ca63c315991a6b74318b8ac4abe602794c8b Request headers accept-language en-US,en;q=0.9 Referer https://www.vedanshbuildingmaterial.in/ User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers date Wed, 10 Jan 2024 19:34:26 GMT content-encoding gzip last-modified Mon, 23 Oct 2023 14:31:34 GMT server nginx x-powered-by Express etag W/"11d6b-18b5cf2bd70" vary Accept-Encoding content-type application/javascript; charset=UTF-8 access-control-allow-origin * cache-control public, max-age=28987682 content-length 21261 expires Wed, 11 Dec 2024 07:42:28 GMT
GET H2	200	77048.436b781c.js Show response static1.jdomni.in/mpstatic/webstore/	125 B 332 B	118ms 117ms	Script application/javascript	2600:1408:ac00:28f::174d AKAMAI-ASN1
General Check archive.org Show headers Download Go to Full URL https://static1.jdomni.in/mpstatic/webstore/77048.436b781c.js Requested by Host: www.vedanshbuildingmaterial.in URL: https://www.vedanshbuildingmaterial.in/ Protocol H2 Security TLS 1.3, , AES_256_GCM Server 2600:1408:ac00:28f::174d Ashburn, United States, ASN20940 (AKAMAI-ASN1, NL), Reverse DNS Software nginx / Express Resource Hash 952c0e13f5d4b2e122ff5447684682e2f9d09303d5f7dd9680196253c4f2c614 Request headers accept-language en-US,en;q=0.9 Referer https://www.vedanshbuildingmaterial.in/ User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers date Wed, 10 Jan 2024 19:34:26 GMT content-encoding gzip last-modified Thu, 29 Apr 2021 15:47:42 GMT server nginx x-powered-by Express etag W/"7d-1791e507d30" vary Accept-Encoding content-type application/javascript; charset=UTF-8 access-control-allow-origin * cache-control public, max-age=31117596 content-length 113 expires Sat, 04 Jan 2025 23:21:02 GMT
GET H2	200	46066.442dc74f.js Show response static1.jdomni.in/mpstatic/webstore/	59 KB 15 KB	108ms 107ms	Script application/javascript	2600:1408:ac00:28f::174d AKAMAI-ASN1
General Check archive.org Show headers Download Go to Full URL https://static1.jdomni.in/mpstatic/webstore/46066.442dc74f.js Requested by Host: www.vedanshbuildingmaterial.in URL: https://www.vedanshbuildingmaterial.in/ Protocol H2 Security TLS 1.3, , AES_256_GCM Server 2600:1408:ac00:28f::174d Ashburn, United States, ASN20940 (AKAMAI-ASN1, NL), Reverse DNS Software nginx / Express Resource Hash 9a41811be3162c7d5d444dcab290d4a7133c19f704a6e7b4aaf012fc9848ef70 Request headers accept-language en-US,en;q=0.9 Referer https://www.vedanshbuildingmaterial.in/ User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers date Wed, 10 Jan 2024 19:34:26 GMT content-encoding gzip last-modified Thu, 29 Apr 2021 15:47:42 GMT server nginx x-powered-by Express etag W/"edeb-1791e507d30" vary Accept-Encoding content-type application/javascript; charset=UTF-8 access-control-allow-origin * cache-control public, max-age=30911002 content-length 15437 expires Thu, 02 Jan 2025 13:57:48 GMT
GET H2	200	41999.93842521.js Show response static1.jdomni.in/mpstatic/webstore/	10 KB 4 KB	114ms 113ms	Script application/javascript	2600:1408:ac00:28f::174d AKAMAI-ASN1
General Check archive.org Show headers Download Go to Full URL https://static1.jdomni.in/mpstatic/webstore/41999.93842521.js Requested by Host: www.vedanshbuildingmaterial.in URL: https://www.vedanshbuildingmaterial.in/ Protocol H2 Security TLS 1.3, , AES_256_GCM Server 2600:1408:ac00:28f::174d Ashburn, United States, ASN20940 (AKAMAI-ASN1, NL), Reverse DNS Software nginx / Express Resource Hash 5dea520346752d2cc91c040427204e730ed645338f608c936a9079355638c05a Request headers accept-language en-US,en;q=0.9 Referer https://www.vedanshbuildingmaterial.in/ User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers date Wed, 10 Jan 2024 19:34:26 GMT content-encoding gzip last-modified Tue, 10 Jan 2023 12:30:57 GMT server nginx x-powered-by Express etag W/"2828-1859ba987e8" vary Accept-Encoding content-type application/javascript; charset=UTF-8 access-control-allow-origin * cache-control public, max-age=30922668 content-length 3714 expires Thu, 02 Jan 2025 17:12:14 GMT
GET H2	200	91384.8f70939a.js Show response static1.jdomni.in/mpstatic/webstore/	116 KB 29 KB	114ms 114ms	Script application/javascript	2600:1408:ac00:28f::174d AKAMAI-ASN1
General Check archive.org Show headers Download Go to Full URL https://static1.jdomni.in/mpstatic/webstore/91384.8f70939a.js Requested by Host: www.vedanshbuildingmaterial.in URL: https://www.vedanshbuildingmaterial.in/ Protocol H2 Security TLS 1.3, , AES_256_GCM Server 2600:1408:ac00:28f::174d Ashburn, United States, ASN20940 (AKAMAI-ASN1, NL), Reverse DNS Software nginx / Express Resource Hash 1417790bf1e9601b97fef3f6d3adf25e16ccae814d70e4f83f410cc0dff1af90 Request headers accept-language en-US,en;q=0.9 Referer https://www.vedanshbuildingmaterial.in/ User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers date Wed, 10 Jan 2024 19:34:26 GMT content-encoding gzip last-modified Wed, 19 Jul 2023 13:21:44 GMT server nginx x-powered-by Express etag W/"1d15f-1896e504e40" vary Accept-Encoding content-type application/javascript; charset=UTF-8 access-control-allow-origin * cache-control public, max-age=30922668 content-length 29820 expires Thu, 02 Jan 2025 17:12:14 GMT
GET H2	200	815DCC41D2330D0FC7AE9EA508_1669186877865.png image1.jdomni.in/banner/23112022/BB/1D/96/	44 KB 45 KB	59ms 59ms	Image image/webp	2600:1408:ec00:681::174d AKAMAI-ASN1
General Check archive.org Show headers Download Go to Show image Full URL https://image1.jdomni.in/banner/23112022/BB/1D/96/815DCC41D2330D0FC7AE9EA508_1669186877865.png?output-format=webp Requested by Host: www.vedanshbuildingmaterial.in URL: https://www.vedanshbuildingmaterial.in/ Protocol H2 Security TLS 1.3, , AES_256_GCM Server 2600:1408:ec00:681::174d Ashburn, United States, ASN20940 (AKAMAI-ASN1, NL), Reverse DNS Software Akamai Image Manager / Resource Hash 1149885a6c7a0701b06b0db37b71e923a3523985458efe60b3a8e28051ae05d7 Request headers accept-language en-US,en;q=0.9 Referer https://www.vedanshbuildingmaterial.in/ User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers date Wed, 10 Jan 2024 19:34:26 GMT last-modified Sat, 06 Jan 2024 03:41:10 GMT server Akamai Image Manager etag "189a58c264b8dafbaafbf560f7371d5a" content-type image/webp access-control-allow-origin * cache-control private, no-transform, max-age=30993362 content-length 45520 expires Fri, 03 Jan 2025 12:50:28 GMT
GET H2	200	icomoon.0232b000.woff2 static1.jdomni.in/mpstatic/webstore/WebStore/fonts/	56 KB 56 KB	169ms 77ms	Font font/woff2	2600:1408:ac00:28f::174d AKAMAI-ASN1
General Check archive.org Show headers Download Go to Full URL https://static1.jdomni.in/mpstatic/webstore/WebStore/fonts/icomoon.0232b000.woff2 Requested by Host: static1.jdomni.in URL: https://static1.jdomni.in/mpstatic/webstore/css/25926.ea41e687.css Protocol H2 Security TLS 1.3, , AES_256_GCM Server 2600:1408:ac00:28f::174d Ashburn, United States, ASN20940 (AKAMAI-ASN1, NL), Reverse DNS Software nginx / Express Resource Hash 15e19345f15ea4cb5934895677df86482236e8c9bf38a6aed9edd5c69bfefeac Request headers Referer https://static1.jdomni.in/mpstatic/webstore/css/25926.ea41e687.css Origin https://www.vedanshbuildingmaterial.in accept-language en-US,en;q=0.9 User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers date Wed, 10 Jan 2024 19:34:26 GMT last-modified Thu, 09 Jun 2022 09:41:54 GMT server nginx x-powered-by Express etag W/"df94-18147d77ed0" content-type font/woff2 access-control-allow-origin * cache-control public, max-age=30085966 accept-ranges bytes content-length 57236 expires Tue, 24 Dec 2024 00:47:12 GMT
GET H2	200	Gilroy-Medium.e29df2ae.woff2 static1.jdomni.in/mpstatic/webstore/gilroy/Gilroy-Medium/fonts/	44 KB 44 KB	123ms 33ms	Font font/woff2	2600:1408:ac00:28f::174d AKAMAI-ASN1
General Check archive.org Show headers Download Go to Full URL https://static1.jdomni.in/mpstatic/webstore/gilroy/Gilroy-Medium/fonts/Gilroy-Medium.e29df2ae.woff2 Requested by Host: static1.jdomni.in URL: https://static1.jdomni.in/mpstatic/webstore/css/22579.5b2c44a3.css Protocol H2 Security TLS 1.3, , AES_256_GCM Server 2600:1408:ac00:28f::174d Ashburn, United States, ASN20940 (AKAMAI-ASN1, NL), Reverse DNS Software nginx / Express Resource Hash 77b848710f616fca4f52367115834ee7646b3b397675c778e45d7a2ec1e0a92c Request headers Referer https://static1.jdomni.in/mpstatic/webstore/css/22579.5b2c44a3.css Origin https://www.vedanshbuildingmaterial.in accept-language en-US,en;q=0.9 User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers date Wed, 10 Jan 2024 19:34:26 GMT last-modified Thu, 29 Apr 2021 15:45:04 GMT server nginx x-powered-by Express etag W/"b0dc-1791e4e1400" content-type font/woff2 access-control-allow-origin * cache-control public, max-age=29455835 accept-ranges bytes content-length 45276 expires Mon, 16 Dec 2024 17:45:01 GMT
GET H2	200	va9E4kDNxMZdWfMOD5Vvl4jLazX3dA.woff2 fonts.gstatic.com/s/firasans/v8/	15 KB 15 KB	99ms 31ms	Font font/woff2	2607:f8b0:4004:c09::5e GOOGLE
General Check archive.org Show headers Download Go to Full URL https://fonts.gstatic.com/s/firasans/v8/va9E4kDNxMZdWfMOD5Vvl4jLazX3dA.woff2 Requested by Host: www.vedanshbuildingmaterial.in URL: https://www.vedanshbuildingmaterial.in/ Protocol H2 Security TLS 1.3, , AES_128_GCM Server 2607:f8b0:4004:c09::5e Ashburn, United States, ASN15169 (GOOGLE, US), Reverse DNS Software sffe / Resource Hash f7e6fbc051b999488b3914a139e192613c9964236075b9fc2278de021918a6d3 Security Headers Name Value X-Content-Type-Options nosniff X-Xss-Protection 0 Request headers Referer https://www.vedanshbuildingmaterial.in/ Origin https://www.vedanshbuildingmaterial.in accept-language en-US,en;q=0.9 User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers date Sat, 06 Jan 2024 21:48:41 GMT x-content-type-options nosniff age 337545 content-security-policy-report-only require-trusted-types-for 'script'; report-uri https://csp.withgoogle.com/csp/apps-themes cross-origin-resource-policy cross-origin alt-svc h3=":443"; ma=2592000,h3-29=":443"; ma=2592000 content-length 14892 x-xss-protection 0 last-modified Tue, 10 Oct 2017 20:52:43 GMT server sffe cross-origin-opener-policy same-origin; report-to="apps-themes" report-to {"group":"apps-themes","max_age":2592000,"endpoints":[{"url":"https://csp.withgoogle.com/csp/report-to/apps-themes"}]} content-type font/woff2 access-control-allow-origin * cache-control public, max-age=31536000 accept-ranges bytes timing-allow-origin * expires Sun, 05 Jan 2025 21:48:41 GMT
GET H2	200	QdVUSTchPBm7nuUeVf70viFl.woff2 fonts.gstatic.com/s/questrial/v7/	13 KB 13 KB	105ms 39ms	Font font/woff2	2607:f8b0:4004:c09::5e GOOGLE
General Check archive.org Show headers Download Go to Full URL https://fonts.gstatic.com/s/questrial/v7/QdVUSTchPBm7nuUeVf70viFl.woff2 Requested by Host: www.vedanshbuildingmaterial.in URL: https://www.vedanshbuildingmaterial.in/ Protocol H2 Security TLS 1.3, , AES_128_GCM Server 2607:f8b0:4004:c09::5e Ashburn, United States, ASN15169 (GOOGLE, US), Reverse DNS Software sffe / Resource Hash dfa736101e7414fa072b888359b5557ced907340e8eceb6c810e7ade956f77ec Security Headers Name Value X-Content-Type-Options nosniff X-Xss-Protection 0 Request headers Referer https://www.vedanshbuildingmaterial.in/ Origin https://www.vedanshbuildingmaterial.in accept-language en-US,en;q=0.9 User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers date Wed, 10 Jan 2024 19:34:26 GMT content-encoding gzip x-content-type-options nosniff content-security-policy-report-only require-trusted-types-for 'script'; report-uri https://csp.withgoogle.com/csp/apps-themes cross-origin-resource-policy cross-origin alt-svc h3=":443"; ma=2592000,h3-29=":443"; ma=2592000 content-length 12809 x-xss-protection 0 last-modified Tue, 10 Oct 2017 23:04:27 GMT server sffe cross-origin-opener-policy same-origin; report-to="apps-themes" vary Accept-Encoding report-to {"group":"apps-themes","max_age":2592000,"endpoints":[{"url":"https://csp.withgoogle.com/csp/report-to/apps-themes"}]} content-type font/woff2 access-control-allow-origin * cache-control public, max-age=31536000 accept-ranges bytes timing-allow-origin * expires Thu, 09 Jan 2025 19:34:26 GMT
GET H/1.1	200 OK	sendCookie.php Show response vedanshenterprisesdelhivishwakarmacolony.justdial.com/marketplace/static/php/web/ Frame 31C1	1 KB 869 B	1294ms 282ms	Document text/html	103.20.127.155 JUSTDIAL-AS-IN Pa...
General Check archive.org Show headers Download Go to Full URL https://vedanshenterprisesdelhivishwakarmacolony.justdial.com/marketplace/static/php/web/sendCookie.php?domain=https://www.vedanshbuildingmaterial.in Requested by Host: static1.jdomni.in URL: https://static1.jdomni.in/mpstatic/webstore/22579.a82ca55d.js Protocol HTTP/1.1 Security TLS 1.2, ECDHE_RSA, AES_128_GCM Server 103.20.127.155 , India, ASN132415 (JUSTDIAL-AS-IN Palm Court Bldg M, 501B, 5th Floor, New Link Road, IN), Reverse DNS Software nginx / Resource Hash 557db7b43a94777cbde1323ce12eeca975c032b34410c6a1381b4a3f75c2df42 Security Headers Name Value Strict-Transport-Security max-age=31536000; includeSubDomains Request headers Referer https://www.vedanshbuildingmaterial.in/ Upgrade-Insecure-Requests 1 User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 accept-language en-US,en;q=0.9 Response headers Access-Control-Allow-Origin http://gammatesting.jdseller.com Connection keep-alive Content-Encoding gzip Content-Type text/html; charset=UTF-8 Date Wed, 10 Jan 2024 19:34:28 GMT Server nginx Strict-Transport-Security max-age=31536000; includeSubDomains Transfer-Encoding chunked Vary Accept-Encoding
GET H2	200	headphones_1.png image3.jdomni.in/jdomni_email/	1 KB 1 KB	66ms 41ms	Image image/webp	2600:1408:5400:4b1::174d AKAMAI-ASN1
General Check archive.org Show headers Download Go to Show image Full URL https://image3.jdomni.in/jdomni_email/headphones_1.png?output-format=webp Requested by Host: www.vedanshbuildingmaterial.in URL: https://www.vedanshbuildingmaterial.in/ Protocol H2 Security TLS 1.3, , AES_256_GCM Server 2600:1408:5400:4b1::174d Ashburn, United States, ASN20940 (AKAMAI-ASN1, NL), Reverse DNS Software Akamai Image Manager / Resource Hash 8a043f8a73fbb0fb398114305b0afbbe5d87293263460671323a7aeabe6e389b Request headers accept-language en-US,en;q=0.9 Referer https://www.vedanshbuildingmaterial.in/ User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers date Wed, 10 Jan 2024 19:34:27 GMT last-modified Thu, 21 Jul 2022 10:33:59 GMT x-serial 237 server Akamai Image Manager x-check-cacheable YES etag "c83defe8ddba967e1d328cf75b0e86cc" content-type image/webp access-control-allow-origin * cache-control private, no-transform, max-age=27417820 content-length 1146 expires Sat, 23 Nov 2024 03:38:07 GMT
POST H/1.1	201 Created	all Show response www.vedanshbuildingmaterial.in/marketplace/cms/nj/feat-product/	158 B 399 B	808ms 788ms	XHR application/json	103.20.127.61 JUSTDIAL-AS-IN Pa...
General Check archive.org Show headers Download Go to Full URL https://www.vedanshbuildingmaterial.in/marketplace/cms/nj/feat-product/all Requested by Host: static1.jdomni.in URL: https://static1.jdomni.in/mpstatic/webstore/75514.3a0762f1.js Protocol HTTP/1.1 Security TLS 1.2, ECDHE_RSA, AES_256_GCM Server 103.20.127.61 , India, ASN132415 (JUSTDIAL-AS-IN Palm Court Bldg M, 501B, 5th Floor, New Link Road, IN), Reverse DNS Software nginx / Express Resource Hash 856db50626c65d6dfcb3fabd5a74ece7520d32fbfdaf237e0050235d26b83a19 Request headers Accept application/json, text/plain, */* Referer https://www.vedanshbuildingmaterial.in/ accept-language en-US,en;q=0.9 User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Content-Type application/json;charset=UTF-8 Response headers Access-Control-Allow-Origin * Date Wed, 10 Jan 2024 19:34:27 GMT Server nginx X-Powered-By Express Content-Length 158 ETag W/"9e-76GNZTN76MJgNvH1tnWoZBaWtE0" Content-Type application/json; charset=utf-8
GET H/1.1	200 OK	getJdRating.ns Show response www.vedanshbuildingmaterial.in/marketplace/webstore/	17 B 437 B	1154ms 480ms	XHR application/json	103.20.127.61 JUSTDIAL-AS-IN Pa...
General Check archive.org Show headers Download Go to Full URL https://www.vedanshbuildingmaterial.in/marketplace/webstore/getJdRating.ns?supplierId=69860051 Requested by Host: static1.jdomni.in URL: https://static1.jdomni.in/mpstatic/webstore/75514.3a0762f1.js Protocol HTTP/1.1 Security TLS 1.2, ECDHE_RSA, AES_256_GCM Server 103.20.127.61 , India, ASN132415 (JUSTDIAL-AS-IN Palm Court Bldg M, 501B, 5th Floor, New Link Road, IN), Reverse DNS Software nginx / Express Resource Hash a59f7638ab73ab4c50cdaf5eba6b75feecc7ee470b9aad5b57903c0b9857d92f Request headers Accept application/json, text/plain, */* Referer https://www.vedanshbuildingmaterial.in/ accept-language en-US,en;q=0.9 User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers Pragma no-cache Date Wed, 10 Jan 2024 19:34:28 GMT Content-Encoding gzip Server nginx X-Powered-By Express ETag W/"11-DghOdjybwxcSdWo11J4kczHbcac" Transfer-Encoding chunked Vary Accept-Encoding Content-Type application/json; charset=utf-8 Access-Control-Allow-Origin http://gammatesting.jdseller.com Cache-Control public, max-age=86400 Expires 0
GET H/1.1	200 OK	getOutletListData.ns Show response www.vedanshbuildingmaterial.in/marketplace/webstore/	565 B 903 B	1135ms 329ms	XHR application/json	103.20.127.61 JUSTDIAL-AS-IN Pa...
General Check archive.org Show headers Download Go to Full URL https://www.vedanshbuildingmaterial.in/marketplace/webstore/getOutletListData.ns?supid=69860051 Requested by Host: static1.jdomni.in URL: https://static1.jdomni.in/mpstatic/webstore/75514.3a0762f1.js Protocol HTTP/1.1 Security TLS 1.2, ECDHE_RSA, AES_256_GCM Server 103.20.127.61 , India, ASN132415 (JUSTDIAL-AS-IN Palm Court Bldg M, 501B, 5th Floor, New Link Road, IN), Reverse DNS Software nginx / Express Resource Hash 4eb55737aceb6ffa902d392a701f6ae6fddd197edd85eee65b6b34bc05b9c0d2 Request headers Accept application/json, text/plain, */* Referer https://www.vedanshbuildingmaterial.in/ accept-language en-US,en;q=0.9 User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers Pragma no-cache Date Wed, 10 Jan 2024 19:34:28 GMT Content-Encoding gzip Server nginx X-Powered-By Express ETag W/"235-mjShpi2opFqnYQaOO1V092Dicf0" Transfer-Encoding chunked Vary Accept-Encoding Content-Type application/json; charset=utf-8 Access-Control-Allow-Origin http://gammatesting.jdseller.com Cache-Control no-cache, no-store, must-revalidate Expires 0
GET H/1.1	200 OK	getCurrentUserData Show response www.vedanshbuildingmaterial.in/omni_ns/	114 B 529 B	1079ms 280ms	XHR application/json	103.20.127.61 JUSTDIAL-AS-IN Pa...
General Check archive.org Show headers Download Go to Full URL https://www.vedanshbuildingmaterial.in/omni_ns/getCurrentUserData?page=homepage Requested by Host: static1.jdomni.in URL: https://static1.jdomni.in/mpstatic/webstore/75514.3a0762f1.js Protocol HTTP/1.1 Security TLS 1.2, ECDHE_RSA, AES_256_GCM Server 103.20.127.61 , India, ASN132415 (JUSTDIAL-AS-IN Palm Court Bldg M, 501B, 5th Floor, New Link Road, IN), Reverse DNS Software nginx / Express Resource Hash c298e80c05e159d79ff33de2445f524d19a14511171087e86b076b3f727ecfc4 Request headers Accept application/json, text/plain, */* Referer https://www.vedanshbuildingmaterial.in/ accept-language en-US,en;q=0.9 User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers Pragma no-cache Date Wed, 10 Jan 2024 19:34:28 GMT Content-Encoding gzip Server nginx X-Powered-By Express ETag W/"72-XwVQKFbmXOtjcBCCVJP16MU8+Xk" Transfer-Encoding chunked Vary Accept-Encoding Content-Type application/json; charset=utf-8 Access-Control-Allow-Origin http://gammatesting.jdseller.com Cache-Control no-cache, no-store, must-revalidate Expires 0
GET H2	200	getLazyData.ns Show response api3.jdomni.com/marketplace/webstore/	5 KB 1 KB	1103ms 1091ms	XHR application/json	2600:1408:ec00:681::174d AKAMAI-ASN1
General Check archive.org Show headers Download Go to Full URL https://api3.jdomni.com/marketplace/webstore/getLazyData.ns?supplierId=69860051&themeId=62890858&baseUrl=https%3A%2F%2Fwww.vedanshbuildingmaterial.in&jdCMSPage=false Requested by Host: static1.jdomni.in URL: https://static1.jdomni.in/mpstatic/webstore/75514.3a0762f1.js Protocol H2 Security TLS 1.3, , AES_256_GCM Server 2600:1408:ec00:681::174d Ashburn, United States, ASN20940 (AKAMAI-ASN1, NL), Reverse DNS Software nginx / Express Resource Hash 1df66dfd981a9aa37449632a0e13a2d6f68c26cd54387874f57b87df8c397627 Request headers Accept application/json, text/plain, */* Referer https://www.vedanshbuildingmaterial.in/ accept-language en-US,en;q=0.9 User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers pragma no-cache date Wed, 10 Jan 2024 19:34:28 GMT content-encoding gzip server nginx x-powered-by Express etag W/"13e4-CUeagM4A9asNYMGQbcwj02DnJ2c" vary Accept-Encoding content-type application/json; charset=utf-8 access-control-allow-origin * cache-control no-cache, no-store, must-revalidate access-control-allow-headers Content-Type content-length 981 expires 0
GET H2	200	headphones_1.png image3.jdomni.in/jdomni_email/	1 KB 1 KB	97ms 97ms	Image image/webp	2600:1408:5400:4b1::174d AKAMAI-ASN1
General Check archive.org Show headers Download Go to Show image Full URL https://image3.jdomni.in/jdomni_email/headphones_1.png?output-format=webp Requested by Host: www.vedanshbuildingmaterial.in URL: https://www.vedanshbuildingmaterial.in/ Protocol H2 Security TLS 1.3, , AES_256_GCM Server 2600:1408:5400:4b1::174d Ashburn, United States, ASN20940 (AKAMAI-ASN1, NL), Reverse DNS Software Akamai Image Manager / Resource Hash 8a043f8a73fbb0fb398114305b0afbbe5d87293263460671323a7aeabe6e389b Request headers accept-language en-US,en;q=0.9 Referer https://www.vedanshbuildingmaterial.in/ User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers date Wed, 10 Jan 2024 19:34:27 GMT last-modified Thu, 21 Jul 2022 10:33:59 GMT x-serial 237 server Akamai Image Manager x-check-cacheable YES etag "c83defe8ddba967e1d328cf75b0e86cc" content-type image/webp access-control-allow-origin * cache-control private, no-transform, max-age=27417820 content-length 1146 expires Sat, 23 Nov 2024 03:38:07 GMT
GET DATA	200 OK	truncated /	758 B 0		Image image/jpeg
General Check archive.org Show headers Download Go to Show image Full URL data:truncated Protocol DATA Server -, , ASN (), Reverse DNS Software / Resource Hash 6bcf4b7b21d29589dd35be222eaf1bbcd7cf24da7cf7402f432a77b4ab378a4d Request headers accept-language en-US,en;q=0.9 Referer User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers Content-Type image/jpeg
GET H2	200	63680.f3e13ffe.js Show response static1.jdomni.in/mpstatic/webstore/	20 KB 7 KB	52ms 50ms	Script application/javascript	2600:1408:ac00:28f::174d AKAMAI-ASN1
General Check archive.org Show headers Download Go to Full URL https://static1.jdomni.in/mpstatic/webstore/63680.f3e13ffe.js Requested by Host: static1.jdomni.in URL: https://static1.jdomni.in/mpstatic/webstore/85758.4936a74c.js Protocol H2 Security TLS 1.3, , AES_256_GCM Server 2600:1408:ac00:28f::174d Ashburn, United States, ASN20940 (AKAMAI-ASN1, NL), Reverse DNS Software nginx / Express Resource Hash 5a8b70311534b2ac1bd7929fade310d790c06509acb3fa4dde71e5e9da206630 Request headers accept-language en-US,en;q=0.9 Referer https://www.vedanshbuildingmaterial.in/ User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers date Wed, 10 Jan 2024 19:34:28 GMT content-encoding gzip last-modified Mon, 29 May 2023 14:29:24 GMT server nginx x-powered-by Express etag W/"51ab-18867e9eda0" vary Accept-Encoding content-type application/javascript; charset=UTF-8 access-control-allow-origin * cache-control public, max-age=30148923 content-length 6863 expires Tue, 24 Dec 2024 18:16:31 GMT
GET H2	200	13076.08c595eb.css static1.jdomni.in/mpstatic/webstore/css/	102 KB 14 KB	192ms 191ms	Stylesheet text/css	2600:1408:ac00:28f::174d AKAMAI-ASN1
General Check archive.org Show headers Download Go to Full URL https://static1.jdomni.in/mpstatic/webstore/css/13076.08c595eb.css Requested by Host: static1.jdomni.in URL: https://static1.jdomni.in/mpstatic/webstore/85758.4936a74c.js Protocol H2 Security TLS 1.3, , AES_256_GCM Server 2600:1408:ac00:28f::174d Ashburn, United States, ASN20940 (AKAMAI-ASN1, NL), Reverse DNS Software nginx / Express Resource Hash 0d52c4f3abdc0a8d5808710a37a9ac34df83d4b133844c63f4266d7543aeca8f Request headers accept-language en-US,en;q=0.9 Referer https://www.vedanshbuildingmaterial.in/ User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers date Wed, 10 Jan 2024 19:34:28 GMT content-encoding gzip last-modified Thu, 09 Feb 2023 13:01:37 GMT server nginx x-powered-by Express etag W/"19961-18636446368" vary Accept-Encoding content-type text/css; charset=UTF-8 access-control-allow-origin * cache-control public, max-age=31536000 content-length 13893 expires Thu, 09 Jan 2025 19:34:28 GMT
GET H2	200	13076.272a78ee.js Show response static1.jdomni.in/mpstatic/webstore/	55 KB 16 KB	42ms 41ms	Script application/javascript	2600:1408:ac00:28f::174d AKAMAI-ASN1
General Check archive.org Show headers Download Go to Full URL https://static1.jdomni.in/mpstatic/webstore/13076.272a78ee.js Requested by Host: static1.jdomni.in URL: https://static1.jdomni.in/mpstatic/webstore/85758.4936a74c.js Protocol H2 Security TLS 1.3, , AES_256_GCM Server 2600:1408:ac00:28f::174d Ashburn, United States, ASN20940 (AKAMAI-ASN1, NL), Reverse DNS Software nginx / Express Resource Hash 08492fb17401d127f05eba285227d062f6204667b895af955d925f6ac4f3b565 Request headers accept-language en-US,en;q=0.9 Referer https://www.vedanshbuildingmaterial.in/ User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers date Wed, 10 Jan 2024 19:34:27 GMT content-encoding gzip last-modified Mon, 19 Jun 2023 08:02:22 GMT server nginx x-powered-by Express etag W/"da90-188d2ad22b0" vary Accept-Encoding content-type application/javascript; charset=UTF-8 access-control-allow-origin * cache-control public, max-age=31536000 content-length 15764 expires Thu, 09 Jan 2025 19:34:27 GMT
GET H2	200	95639.8476cbb2.css static1.jdomni.in/mpstatic/webstore/css/	14 KB 4 KB	53ms 53ms	Stylesheet text/css	2600:1408:ac00:28f::174d AKAMAI-ASN1
General Check archive.org Show headers Download Go to Full URL https://static1.jdomni.in/mpstatic/webstore/css/95639.8476cbb2.css Requested by Host: static1.jdomni.in URL: https://static1.jdomni.in/mpstatic/webstore/85758.4936a74c.js Protocol H2 Security TLS 1.3, , AES_256_GCM Server 2600:1408:ac00:28f::174d Ashburn, United States, ASN20940 (AKAMAI-ASN1, NL), Reverse DNS Software nginx / Express Resource Hash 97fbf66b5a0a3687c61c85d9dabcb26851e485e58e4843399142787b1380df84 Request headers accept-language en-US,en;q=0.9 Referer https://www.vedanshbuildingmaterial.in/ User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers date Wed, 10 Jan 2024 19:34:28 GMT content-encoding gzip last-modified Mon, 29 May 2023 14:29:24 GMT server nginx x-powered-by Express etag W/"3815-18867e9eda0" vary Accept-Encoding content-type text/css; charset=UTF-8 access-control-allow-origin * cache-control public, max-age=30424393 content-length 3425 expires Fri, 27 Dec 2024 22:47:41 GMT
GET H2	200	95639.f722a76f.js Show response static1.jdomni.in/mpstatic/webstore/	15 KB 6 KB	44ms 43ms	Script application/javascript	2600:1408:ac00:28f::174d AKAMAI-ASN1
General Check archive.org Show headers Download Go to Full URL https://static1.jdomni.in/mpstatic/webstore/95639.f722a76f.js Requested by Host: static1.jdomni.in URL: https://static1.jdomni.in/mpstatic/webstore/85758.4936a74c.js Protocol H2 Security TLS 1.3, , AES_256_GCM Server 2600:1408:ac00:28f::174d Ashburn, United States, ASN20940 (AKAMAI-ASN1, NL), Reverse DNS Software nginx / Express Resource Hash c6f00426690dcd389290747a7cf865fc21ec110e9bb04ca200a373cfd1cdd76f Request headers accept-language en-US,en;q=0.9 Referer https://www.vedanshbuildingmaterial.in/ User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers date Wed, 10 Jan 2024 19:34:28 GMT content-encoding gzip last-modified Thu, 31 Mar 2022 11:54:49 GMT server nginx x-powered-by Express etag W/"3c4b-17fdfd40728" vary Accept-Encoding content-type application/javascript; charset=UTF-8 access-control-allow-origin * cache-control public, max-age=31536000 content-length 5581 expires Thu, 09 Jan 2025 19:34:28 GMT
GET H/1.1	200 OK	crunch-details Show response www.vedanshbuildingmaterial.in/marketplace/cms/nj/feat-product/	19 B 340 B	347ms 346ms	XHR application/json	103.20.127.61 JUSTDIAL-AS-IN Pa...
General Check archive.org Show headers Download Go to Full URL https://www.vedanshbuildingmaterial.in/marketplace/cms/nj/feat-product/crunch-details?supplierId=69860051 Requested by Host: static1.jdomni.in URL: https://static1.jdomni.in/mpstatic/webstore/75514.3a0762f1.js Protocol HTTP/1.1 Security TLS 1.2, ECDHE_RSA, AES_256_GCM Server 103.20.127.61 , India, ASN132415 (JUSTDIAL-AS-IN Palm Court Bldg M, 501B, 5th Floor, New Link Road, IN), Reverse DNS Software nginx / Express Resource Hash 72bebc415d4b7fe9b75f00431d8069c090179e15d50d7a8b4777958164d3bc2e Request headers Accept application/json, text/plain, */* Referer https://www.vedanshbuildingmaterial.in/ accept-language en-US,en;q=0.9 User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers Date Wed, 10 Jan 2024 19:34:28 GMT Content-Encoding gzip Server nginx X-Powered-By Express ETag W/"13-aVsgs1e+gJit8NZQFWYxFr5IMp4" Transfer-Encoding chunked Vary Accept-Encoding Content-Type application/json; charset=utf-8 Access-Control-Allow-Origin *
GET H/1.1	200 OK	getIPLocation.ns Show response www.vedanshbuildingmaterial.in/marketplace/	366 B 660 B	698ms 698ms	XHR application/json	103.20.127.61 JUSTDIAL-AS-IN Pa...
General Check archive.org Show headers Download Go to Full URL https://www.vedanshbuildingmaterial.in/marketplace/getIPLocation.ns Requested by Host: static1.jdomni.in URL: https://static1.jdomni.in/mpstatic/webstore/75514.3a0762f1.js Protocol HTTP/1.1 Security TLS 1.2, ECDHE_RSA, AES_256_GCM Server 103.20.127.61 , India, ASN132415 (JUSTDIAL-AS-IN Palm Court Bldg M, 501B, 5th Floor, New Link Road, IN), Reverse DNS Software nginx / Express Resource Hash 30d4edfc6c244c3df8f1e3c9744890d23f82f1d0f0f7bcd04c63a6873963978b Request headers Accept application/json, text/plain, */* Referer https://www.vedanshbuildingmaterial.in/ accept-language en-US,en;q=0.9 User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Response headers Pragma no-cache Date Wed, 10 Jan 2024 19:34:28 GMT Content-Encoding gzip Server nginx X-Powered-By Express ETag W/"16e-xOusWQVKyLFm82twmmtEcv6EM58" Transfer-Encoding chunked Vary Accept-Encoding Content-Type application/json; charset=utf-8 Access-Control-Allow-Origin http://gammatesting.jdseller.com Cache-Control no-cache, no-store, must-revalidate Expires 0
POST H/1.1	200 OK	setUserSession Show response www.vedanshbuildingmaterial.in/omni_ns/	422 B 691 B	254ms 253ms	XHR application/json	103.20.127.61 JUSTDIAL-AS-IN Pa...
General Check archive.org Show headers Download Go to Full URL https://www.vedanshbuildingmaterial.in/omni_ns/setUserSession Requested by Host: static1.jdomni.in URL: https://static1.jdomni.in/mpstatic/webstore/75514.3a0762f1.js Protocol HTTP/1.1 Security TLS 1.2, ECDHE_RSA, AES_256_GCM Server 103.20.127.61 , India, ASN132415 (JUSTDIAL-AS-IN Palm Court Bldg M, 501B, 5th Floor, New Link Road, IN), Reverse DNS Software nginx / Express Resource Hash 014110f7c3bf3966966fe91680d2a0cb8dc4ceaa328292ac178df13e04549938 Request headers Accept application/json, text/plain, */* Referer https://www.vedanshbuildingmaterial.in/ accept-language en-US,en;q=0.9 User-Agent Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/120.0.6099.216 Safari/537.36 Content-Type application/json;charset=UTF-8 Response headers Pragma no-cache Date Wed, 10 Jan 2024 19:34:29 GMT Content-Encoding gzip Server nginx X-Powered-By Express ETag W/"1a6-4/q6RXNihDphqhPBLMEaATu1u6Q" Transfer-Encoding chunked Vary Accept-Encoding Content-Type application/json; charset=utf-8 Access-Control-Allow-Origin http://gammatesting.jdseller.com Cache-Control no-cache, no-store, must-revalidate Expires 0

111 JavaScript Global Variables

These are the non-standard "global" variables defined on the window object. These can be helpful in identifying possible client-side frameworks and code.

object| documentPictureInPicture string| WEBROOT string| STOREID string| NO_IMAGE string| COOKIE_DOMAIN string| MDOCIDJ string| GCYCITY string| domainname string| docid string| supid string| verticalId string| loginId string| bid string| baseurl string| pagename string| pageid string| pagerefid string| account_mongo_id string| verticalid string| outletid object| jdOmni string| psvid string| others string| omnipath string| suptype boolean| isMobileOtpMandatory boolean| isEmailMandatory string| gcycurpage string| sortby object| menuList string| mode string| storename string| themeCompanyName object| webListingPageSettings string| static_img string| themeId string| themeid string| headerClass string| scrollToBlock object| outletInfo string| appLink string| deviceType boolean| isCartAddButtonEnabled string| domain_name string| ISD_Code string| countryId string| onsignup string| paidStatus function| isPrivateModeSafari boolean| LocalStorageAvailable object| payload function| $ function| jQuery function| ES6Promise object| __LOADABLE_LOADED_CHUNKS__ object| __core-js_shared__ object| core function| checkForClickPrevent object| jQuery1102025972462122715845 function| trackOrder function| getParameterByName function| setStoreNameFontSize object| popoverHideTimeout function| handleMenuLinks function| closeMenuLinkPopover function| setLang object| countryListArr function| getCountryList function| showToastMsgWeb function| hideToastMsgWeb function| highlightLangInFooter function| getElementVisibility function| cmsAnimationInitilization undefined| loggedin_mob undefined| loggedin_email string| paymentDescription object| userInfo function| logoutCustomer undefined| shareurl function| setDefaultValue function| showhide function| showHideFilterLoader function| onEnter function| getUserData string| modalType function| initializeGallery function| setCookie function| externalLinkHandler function| adjustFloatingCartIcon function| setMiddleSectionHeight function| scrollToContentBlock function| initializeDetailPage function| isEditModeFormSelector function| createExternalLink object| $fakeShopName object| menuLinkFunctions object| galleryPreview function| updateJdRating function| showHideModal function| showSearchForm function| toggleOutletModal function| pushUrlInHistory function| storeAction undefined| updateSmartFill function| togglePrescriptionModal object| ToastMessage function| toggleSliderModal string| webheaderColor boolean| isIframe string| x string| htmlLink

3 Cookies

Cookies are little pieces of information stored in the browser of a user. Whenever a user visits the site again, he will also send his cookie values, thus allowing the website to re-identify him even if he changed locations. This is how permanent logins work.

			Domain/Path	Expires	Name / Value
			.www.vedanshbuildingmaterial.in/	1970-01-20 17:35:46	Name: googtrans Value: /en/en
			.vedanshbuildingmaterial.in/	1970-01-20 17:35:46	Name: googtrans Value: /en/en
			www.vedanshbuildingmaterial.in/	1970-01-21 02:20:51	Name: NSSESSION Value: s%3AGak7jXi_YDCNBJv9wyGYwHw1hTpePMOO.ObI%2FzG9PmjLeHYzv0JLsD15Xl0PbKxx9KfaWZtRvEII

Security Headers

This page lists any security headers set by the main page. If you want to understand what these mean and how to use them, head on over to this page

Header	Value
Content-Security-Policy	frame-ancestors 'none';
X-Frame-Options	sameorigin