www.homeinsightstore.co.uk
Open in
urlscan Pro
52.17.85.125
Public Scan
Submitted URL: http://homeinsightstore.co.uk/
Effective URL: https://www.homeinsightstore.co.uk/
Submission: On March 29 via manual from NL — Scanned from NL
Effective URL: https://www.homeinsightstore.co.uk/
Submission: On March 29 via manual from NL — Scanned from NL
Form analysis
2 forms found in the DOMGET https://www.homeinsightstore.co.uk/index.aspx?pageid=TYQaz
<form action="https://www.homeinsightstore.co.uk/index.aspx?pageid=TYQaz" method="get"><input name="pageid" id="pageid" type="hidden" value="TYQaz"><input name="chainID" id="chainID" type="hidden" value="874711">
<div class="search" data-editor-type="search">
<div class="search_container">
<input type="text" id="txtQuickSearch" name="txtQuickSearch" placeholder="search" aria-label="product search">
<button aria-label="search"><i class="fas fa-search" aria-hidden="true"></i></button>
<div id="search_container_close"><i class="fas fa-times" aria-hidden="true"></i></div>
</div>
</div>
</form>
<form class="stretch mx-2 flex flex-row gap-3 last:mb-2 md:mx-4 md:last:mb-6 lg:mx-auto lg:max-w-3xl">
<div class="relative flex h-full flex-1 md:flex-col">
<div class="flex ml-1 md:w-full md:m-auto md:mb-2 gap-0 md:gap-2 justify-center">
<div class="flex w-full items-center justify-center gap-2"><svg stroke="currentColor" fill="none" stroke-width="1.5" viewBox="0 0 24 24" stroke-linecap="round" stroke-linejoin="round" class="h-3 w-3" height="1em" width="1em"
xmlns="http://www.w3.org/2000/svg">
<polyline points="1 4 1 10 7 10"></polyline>
<polyline points="23 20 23 14 17 14"></polyline>
<path d="M20.49 9A9 9 0 0 0 5.64 5.64L1 10m22 4l-4.64 4.36A9 9 0 0 1 3.51 15"></path>
</svg></div>
</div>
</div>
</form>
Text Content
PKR AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL Menu HomeAboutCartContactOffers Store Baby Care Welcome to abdullah-zafar Sign In PKR AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL HomeAboutCartContactOffers Store Baby Care 0 Rs0.00 * * < * > Welcome to Hi store, the premier destination for an extensive selection of household items, pet-related products, baby care essentials, stationery items, toys and games, sports-related merchandise, arts and crafts supplies, and seasonal products. Our store is committed to providing our customers with a one-stop shopping experience where they can find everything they need under one roof. At Hi store, we take pride in our commitment to providing high-quality products at competitive prices. Our team of experienced professionals works tirelessly to source products from reliable suppliers to ensure that our customers receive only the best products available in the market. From everyday household essentials to seasonal products, we strive to offer a diverse range of products to meet the unique needs of our customers. We understand that our customers' time is valuable, which is why we are dedicated to providing a convenient and seamless shopping experience. With a user-friendly website, easy payment methods, and fast shipping, we make sure that our customers enjoy a hassle-free shopping experience every time they visit our store. Whether you're shopping for your home, your pet, or your children, Hi store is your go-to destination for all your needs. Thanks! Featured Products Johnson's Unisex-Baby powder 3 pack (1500g) Rs10.99 Add To Cart Popular Categories New Products Johnson's Unisex-Baby powder 3 pack (1500g) Rs10.99 Add To Cart © 2023. abdullah-zafarFree ecommerce templates Store Links TermsPrivacySitemap MODAL DIALOG TITLE Modal Dialog Content Cancel Ok Create a free online store Powered by freewebstore.com Get your free online store today - Be your own boss! freewebstore Got a great business idea? Get a free online store just like this one! What do I get? Hosted online store Unlimited products Domain & SSL checkout 24/7 support And more... Why freewebstore? 10+ years 650k stores created No card required Easy to create What's the catch? No catch 0% commission Free forever! Feature upgrades available Get Started i ? Start your own online business today - click here freewebstore