pecan-auth-stack-rewrite.staging.stjude.cloud
Open in
urlscan Pro
52.151.240.216
Public Scan
URL:
https://pecan-auth-stack-rewrite.staging.stjude.cloud/
Submission: On August 15 via automatic, source certstream-suspicious — Scanned from DE
Submission: On August 15 via automatic, source certstream-suspicious — Scanned from DE
Form analysis
0 forms found in the DOMText Content
We're sorry but PeCan | St. Jude Cloud doesn't work properly without JavaScript enabled. Please enable it to continue. St. Jude CloudPeCan * Sign In * Research Domains * Pediatric Cancer * Cancer Survivorship * Non-cancerous Diseases Apps * Genomics Platform Data & Tools * Model Systems * PeCan * Visualization Community * View All Apps Featured Study * Real-time Clinical Genomics * View All Studies Support * Help Guides * FAQs * Contact Us HomePIEDocumentation diagnosis HomePIEDocumentation diagnosis Click here to get started EXPLORE CURATED DATA FROM ~ 9000 PEDIATRIC CANCER SAMPLES DATA FACETS & TOOLS VARIANTS MUTATIONAL SIGNATURES EXPRESSION HISTOLOGY PIE CURATED DATA The PeCan platform presents curated pediatric cancer genomics data including variants, mutational signatures, and gene expression data in addition to histological slide images* from ~9000 hematological, CNS, and non-CNS solid tumor patient samples. Data can be explored via a series of data facets containing both retrospective and prospective study cohorts from St. Jude Children's Research Hospital and other trusted institutions and research centers around the world. *Note that a number of histological slide images are currently embargoed until publication of the associated study. CONTRIBUTING INSTITUTIONS Variants VARIANTS EXPLORE CURATED VARIANTS VIA INTERACTIVE VISUALIZATIONS. Perform exploratory research of variants in pediatric cancer subtypes via 5 custom interactive interfaces. Curated variants have been identified from whole-genome, whole-exome and whole-transcriptome (RNA-seq) sequencing data from 5500 samples. Explore Variants FEATURES ONCOPRINT Variant landscape view summarizing variant presence and frequency across samples for a given diagnosis subtype. View Oncoprint VARIANT PREVALENCE Display of gene level variant type composition within a given diagnosis subtype. View Variant Prevalence GENOMEPAINT A visualization tool that integrates whole-genome, whole-exome, transcriptome, and epigenomic data of tumor samples. View GenomePaint PROTEINPAINT Gene level display of variants presented on a protein domain view and scaled by prevalence. View ProteinPaint VARIANT DETAILS Individual customized variant pages displaying detailed associated genomic, clinical, classification, and observed population frequency annotations. Mutational Signatures MUTATIONAL SIGNATURES INVESTIGATE COSMIC SBS MUTATIONAL SIGNATURES AMONG PEDIATRIC CANCER SUBTYPES. Use our tiered interface to observe COSMIC single base substitution (SBS) mutational signatures identified across cancer subtypes and samples therein. Explore Mutational Signatures FEATURES SUBTYPE HEATMAP Observe COSMIC SBS signatures across pediatric cancer subtypes via an interactive heatmap view - providing a gateway to further explore signatures within each subtype and individual samples. SAMPLE COHORT VIEW View identified COSMIC SBS signatures in groups of samples grouped by cancer subtype or subtypes with a specific mutational signature displayed as a barplot. SAMPLE VIEW View individual sample mutational profiles together with identified COSMIC SBS signatures. Expression GENE EXPRESSION MAP-BASED EXPLORE PEDIATRIC TUMOR SAMPLES WITHIN 2-DIMENSIONAL EXPRESSION LANDSCAPE MAPS. Explore hematologic, CNS, and non-CNS solid tumor RNA-seq expression landscape maps to select tumor samples of interest. Explore Expression FEATURES PAN-CANCER EXPRESSION MAPS Presenting interactive expression maps for each of hematologic, CNS, and non-CNS solid tumor cancer subtypes derived from RNA-seq expression data. SEARCH AND FILTER Highlight samples of interest by performing keyword searches of sample id, tumor subtype, cohort, subtype-biomarker etc. Alternatively, our interface enables custom advanced filtering to display samples of interest. SAMPLE VIEW AND LASSO Hover over a sample on each expression map to view its metadata. Alternatively, our lasso tool enables selection and listing of multiple samples and associated metadata. Histology HISTOLOGY EXPLORE, SEARCH AND FILTER HISTOLOGY SLIDE IMAGES OF PEDIATRIC SOLID TUMOR SAMPLES. Examine H&E histology slide images and associated clinical notes from a wide variety of pediatric solid tumor subtypes. Explore Histology FEATURES SEARCH AND FILTER Select to view histology slide images via filtering on cancer subtype and/or clinical metadata via our search navigation interface. In addition, images can be searched by sampleID. SLIDE VIEWER Carefully examine slide images (zoom to 10x magnification) with our dynamic high-resolution slide viewer (supported by OpenSeaDragon). IMAGE SEARCH COMING SOON! Upload your own slide and use our image search tool to identify similar images within minutes! PIE - Pathogenicity Information Exchange PIE - PATHOGENICITY INFORMATION EXCHANGE A VARIANT CLASSIFICATION AND INTERPRETATION SERVICE. PIE automates annotations, classifies, and triages variants via our Medal Ceremony pipeline. PIE also provides interactive variant pages with visualization tools to support expert curation. Further, PIE supplies a reference database of expert-vetted cancer-predisposing germline mutations. Explore PIE PeCanPIE was originally developed for pediatric cancer but can be easily extended for use for non-pediatric cancers and non-cancer genetic diseases. FEATURES RUN PIE JOBS Submit your VCF file or enter a single variant to run through our Medal Ceremony pipeline. ST. JUDE MEDAL CEREMONY PIE implements our clinical Medal Ceremony pipeline - whereby variants within disease-related genes are assigned a 'Gold', 'Silver', or 'Bronze' putative pathogenicity class. COLLABORATE Invite team members to view the results of your PIE jobs - providing them with full access to your processed data results. NEED OUR ASSISTANCE? Access our help guides – on how to cite us, who to contact for support, or to learn more about each of the data facets or tools. Visit Our Help Guides GENOMIC AND PROTEOMIC DATA AND ANALYSIS RESOURCES FOR THE GLOBAL RESEARCH COMMUNITY. Genomics Platform Sequencing Data and Analysis Access and analyze the world's most comprehensive repositories of pediatric cancer-related genomics data and analysis tools. Access Data Visualization Community Interactive Figures Create and share figures using St. Jude's unique genomic visualization tools such as ProteinPaint and GenomePaint. See Visualizations Model Systems Xenograft knowledge base Access and analyze the world's most comprehensive repositories of pediatric cancer-related genomics data and analysis tools. Explore Models St. Jude Cloud ABOUT * Home * Contact * Careers * Privacy Policy * Terms of Use APPS * Genomics Platform * Model Systems * Pediatric Cancer Portal (PeCan) * Visualization Community FOLLOW US * Privacy• * Disclaimer / Registrations / Copyright• * Linking• * Privacy (HIPAA)• * Non-Discrimination © Copyright 2023 St. Jude Children's Research Hospital , a not-for-profit, section 501(c)(3). SAMPLES 8540 SUBJECTS 7655 DIAGNOSIS SELECTION HM Hematologic Malignancy ST Solid Tumor BT Brain Tumor GCT Germ Cell Tumor Brain TumorSolid tumorHematologic MalignancyGerm Cell TumorChoroid PlexusEmbryonal, BrainEpendymomalGliomaMeningothelial TumorNeuroepithelial/Glioneuronal TumorOther Brain TumorPinealSellarAdrenal GlandBladder/Urinary TractBoneBowelEyeHead and NeckKidneyLiverLungOther Solid TumorOvary/Fallopian TubePancreasPeripheral Nervous SystemSkinSoft TissueThymusThyroidLymphoid NeoplasmMyeloid NeoplasmOther Hematologic MalignancyMixed Germ Cell Tumor, BrainYolk Sac Tumor, BrainMixed Germ Cell Tumor, TestisOvarian Germ Cell TumorYolk Sac Tumor, OvaryYolk Sac Tumor, ParotidAtypical Choroid Plexus PapillomaChoroid Plexus CarcinomaChoroid Plexus PapillomaAtypical Teratoid/Rhabdoid TumorEmbryonal Tumor, BrainEmbryonal Tumor with Multilayered Rosettes, BrainMedulloblastomaPrimitive Neuroectodermal TumorEpendymomal Tumor, AnaplasticAnaplastic Ependymoma, Posterior FossaEpendymomal Tumor, NOSEpendymomal Tumor, Posterior FossaEpendymomal Tumor, Spinal TumorEpendymomal Tumor, SupratentorialMixed Myxopapillary Anaplastic Ependymoma, Spinal TumorMyxopapillary EpendymomaMyxopapillary Ependymoma, Fourth VentricleMyxopapillary Ependymoma, Posterior FossaAstrocytoma, NOSDiffuse GliomaEncapsulated GliomaGlioma, NOSMeningiomaAngiocentric GliomaCentral NeurocytomaDesmoplastic Infantile AstrocytomaDesmoplastic Infantile GangliogliomaGlioneuronal Neoplasm, NOSHigh-Grade Glioneuronal TumorHigh-Grade Neuroepithelial TumorLow-Grade Glioneuronal TumorLow-Grade Neuroepithelial TumorAcoustic NeuromaBrain Tumor, NOSCNS Ewing Sarcoma Family Tumor, CIC alterationCIC-Rearranged Sarcoma, BrainHigh-Grade Calvarium SarcomaIntracranial Mesenchymal Tumor, FET-CREBMiscellaneous Brain TumorPineal Anlage TumorPineoblastomaPineocytomaPineal TumorPineal Parenchymal TumorPineal Parenchymal Tumor of Intermediate DifferentiationPapillary Tumor of the Pineal RegionCraniopharyngioma, Adamantinomatous TypeAdrenocortical AdenomaAdrenocortical CarcinomaAdrenocortical Tumor, Uncertain Malignant PotentialPheochromocytomaMalignant Rhabdoid Tumor of the BladderAneurysmal Bone CystAtypical Osteocartilaginous LesionChondroblastomaChordomaChondroblastic OsteosarcomaChondrosarcomaEwing SarcomaGiant Cell Tumor of BoneGiant Cell Tumor, NOSMesenchymal ChondrosarcomaMyositis OssificansOsteoblastomaOsteoid OsteomaOsteosarcomaOsteoblastic OsteosarcomaGastrointestinal Neuroendocrine TumorGastrointestinal Stromal TumorInflammatory Myofibroblastic Stomach TumorSignet Ring Cell Carcinoma of the StomachAdenoid Cystic Carcinoma of the Lacrimal GlandRetinoblastomaAdenoid Cystic Carcinoma of the Salivary GlandAdenomatoid Odontogenic TumorMucoepidermoid CarcinomaMyoepithelial CarcinomaNasopharyngeal CarcinomaNeurothekeomaPleomorphic AdenomaSialoblastomaSalivary Gland Anlage TumorClear Cell Sarcoma of KidneyCongenital Mesoblastic NephromaRenal Epitheloid AngiomyolipomaJuxtagliomerular Cell TumorJuvenile XanthogranulomaLow-Grade Oncocytic Renal TumorRhabdoid Cancer, KidneyPapillary Renal Cell CarcinomaRenal Cell CarcinomaWilmsWilms, BilateralHepatoblastomaHepatocellular CarcinomaHepatic Focal Nodular HyperplasiaMalignant Rhabdoid Tumor of the LiverUndifferentiated Embryonal Sarcoma of the LiverInflammatory Myofibroblastic Lung TumorCarcinoma, NOSRhabdoid Tumor, NOSSolid Cancer of Unknown PrimaryMucinous Adenocarcinoma, OvarianSex Cord Stromal TumorSertoli-Leydig Cell TumorPancreatic Neuroendocrine TumorSolid Pseudopapillary Neoplasm of the PancreasGanglioneuroblastomaLow-Grade Peripheral Nerve Sheath TumorMalignant Peripheral Nerve Sheath TumorNeuroblastomaNeurofibromaNeuromuscular ChoristomaSchwannomaAtypical NevusAtypical Spitzoid Melanocytic NeoplasmAtypical Spitzoid NeoplasmCongenital Melanocytic NevusDermatofibrosarcoma ProtuberansMelanomaMelanocytic NevusNodular Malignant MelanomaSquamous Cell Carcinoma, NOSCutaneous Melanoma, CRTC1-TRIM11Spitzoid MelanomaNon-Rhabdomyosarcoma Soft Tissue TumorRhabdomyosarcomaMalignant ThymomaNon-Invasive Follicular Thyroid Neoplasm with Papillary Like Nuclear FeaturesNodular Thyroid HyperplasiaSpindle Epithelial Tumor with Thymus-Like DifferentiationThyroid Gland Follicular Adenoma with Papillary HyperplasiaFollicular Thyroid CancerHurthle Cell Thyroid CancerMedullary Thyroid CancerPapillary Thyroid CancerAcute Lymphoblastic Leukemia, NOSB-Cell Lymphoblastic LeukemiaNon-Hodgkin LymphomaT-Cell Lymphoblastic LeukemiaAcute Myeloid LeukemiaChronic Myeloid LeukemiaMyelodysplastic SyndromesMyeloproliferative NeoplasmsMyeloid SarcomaTherapy Related Myeloproliferative NeoplasmAtypical Dendritic Cell TumorAcute Leukemias of Ambiguous LineageAcute Undifferentiated LeukemiaAcute Undifferentiated Leukemia, KMT2A rearrangementBlood Cancer of Unknown PrimaryEosinophilia, NOSMixed Phenotype Acute Leukemia, T/Myeloid, NOSRosai-Dorfman DiseaseAtypical Teratoid/Rhabdoid Tumor, SHH subgroupAtypical Teratoid/Rhabdoid Tumor, TYR subgroupLarge Cell/Anaplastic MedulloblastomaAnaplastic Medulloblastoma, Group 3Anaplastic Medulloblastoma, Group 4Large Cell/Anaplastic Medulloblastoma, SHH subtypeDesmoplastic/Nodular Medulloblastoma, SHH subtypeMedulloblastoma with Extensive Nodularity, SHH subtypeMedulloblastoma, Group 3Medulloblastoma, Group 4Medulloblastoma, SHH subtypeMedulloblastoma, WNT subtypeAnaplastic AstrocytomaAnaplastic OligoastrocytomaDiffuse AstrocytomaDiffuse Intrinsic Pontine GliomaGlioblastomaHigh-Grade Glioma, NOSOligoastrocytomaOligodendrogliomaAnaplastic GangliogliomaAnaplastic Pleomorphic XanthoastrocytomaDysembryoplastic Neuroepithelial TumorGangliogliomaLow-Grade Glioma, NOSPilocytic AstrocytomaPilomyxoid AstrocytomaPleomorphic XanthoastrocytomaAdenocarcinoma, NOSAngiomatoid Fibrous HistiocytomaFibrosarcoma, AbdominalAlveolar Soft Part SarcomaBCOR SarcomaClear Cell SarcomaDesmoid/Aggressive FibromatosisDesmoplastic Small Round Cell TumorEpithelioid SarcomaEwing Sarcoma of Soft TissueFibromyxoid SarcomaFibroblastic/Myofibroblastic TumorFibrous Umbilical PolypGiant Cell FibroblastomaHigh Grade SarcomaInfantile FibrosarcomaInflammatory Myofibroblastic TumorLipoblastomaLipofibromatosisLow-Grade Mesenchymal NeoplasmLiposarcomaMyopericytomaParagangliomaRound Cell Sarcoma, NOSSarcoma, NOSSpindle Cell NeoplasmSpindle Cell Sarcoma, NOSSerous cystadenomaSynovial SarcomaUndifferentiated Round Cell SarcomaAlveolar RhabdomyosarcomaBotryoid Type Embryonal RhabdomyosarcomaEmbryonal RhabdomyosarcomaEctomesenchymomaRhabdomyosarcoma, NOSSpindle Cell RhabdomyosarcomaSpindle Cell/Sclerosing RhabdomyosarcomaB-Cell Acute Lymphoblastic Leukemia, BCR-ABL1B-Cell Acute Lymphoblastic Leukemia, BCR-ABL1 likeB-Cell Acute Lymphoblastic Leukemia, CRLF2 rearrangementB-Cell Acute Lymphoblastic Leukemia, DUX4-IGHB-Cell Acute Lymphoblastic Leukemia, DUX4-IGH likeB-Cell Acute Lymphoblastic Leukemia, ETV6-RUNX1B-Cell Acute Lymphoblastic Leukemia, ETV6-RUNX1 likeB-Cell Acute Lymphoblastic Leukemia, HLF rearrangementB-Cell Acute Lymphoblastic Leukemia, HyperdiploidyB-Cell Acute Lymphoblastic Leukemia, HypodiploidyB-Cell Acute Lymphoblastic Leukemia, iAMP21B-Cell Acute Lymphoblastic Leukemia, IGH-CEBPDB-Cell Acute Lymphoblastic Leukemia, IKZF1 N159YB-Cell Acute Lymphoblastic Leukemia, KMT2A rearrangementB-Cell Acute Lymphoblastic Leukemia, MEF2D rearrangementB-Cell Acute Lymphoblastic Leukemia, MYC rearrangementB-Cell Acute Lymphoblastic Leukemia, NOSB-Cell Acute Lymphoblastic Leukemia, NUTM1 rearrangementB-Cell Acute Lymphoblastic Leukemia, PAX5 alterationB-Cell Acute Lymphoblastic Leukemia, PAX5 P80RB-Cell Acute Lymphoblastic Leukemia, TCF3-PBX1B-Cell Acute Lymphoblastic Leukemia, ZNF384 rearrangementB-Cell Acute Lymphoblastic Leukemia, ZNF384 rearrangement likeAnaplastic Large Cell LymphomaAnaplastic Large Cell Lymphoma, ALK PositiveBurkitt LymphomaB-Cell Lymphoblastic Lymphoma, BCR-ABL1 likeB-Cell Lymphoblastic Lymphoma, NOSB-Cell Lymphoblastic Lymphoma, TCF3-HLFB-Cell Lymphoblastic Lymphoma, TCF3-PBX1Diffuse Large B-Cell Lymphoma, NOSExtranodal Marginal Zone LymphomaFollicular LymphomaHigh-Grade B-Cell Lymphoma, NOSMature B-Cell NeoplasmsT-Cell Lymphoblastic Lymphoma, LMO1 rearrangementT-Cell Lymphoblastic Lymphoma, NKX2 rearrangementT-Cell Lymphoblastic Lymphoma, NOST-Cell Lymphoblastic Lymphoma, TAL1 rearrangementT-Cell Acute Lymphoblastic Leukemia, BCL11B rearrangementT-Cell Acute Lymphoblastic Leukemia, HOXA activationT-Cell Acute Lymphoblastic Leukemia, LMO2 activationT-Cell Acute Lymphoblastic Leukemia, NKX2 activationT-Cell Acute Lymphoblastic Leukemia, NOST-Cell Acute Lymphoblastic Leukemia, SPI1 rearrangementT-Cell Acute Lymphoblastic Leukemia, TAL1 activationT-Cell Acute Lymphoblastic Leukemia, TAL2 activationT-Cell Acute Lymphoblastic Leukemia, TLX1 activationT-Cell Acute Lymphoblastic Leukemia, TLX3 activationAcute Megakaryoblastic LeukemiaAcute Megakaryoblastic Leukemia, CBFA2T3-GLIS2Acute Megakaryoblastic Leukemia, KMT2A rearrangementAcute Megakaryoblastic Leukemia, RBM15-MKL1Acute Myeloid Leukemia, CBFA2T3-GLIS2Acute Myeloid Leukemia, CBFB-MYH11Acute Myeloid Leukemia, Core Binding Factor, NOSAcute Myeloid Leukemia, biallelic CEBPA alterationAcute Myeloid Leukemia, DEK-NUP214Acute Myeloid Leukemia, ETS family rearrangementAcute Myeloid Leukemia, GATA1 alterationAcute Myeloid Leukemia, HOX rearrangementAcute Myeloid Leukemia, KAT6A rearrangementAcute Myeloid Leukemia, KMT2A rearrangementAcute Myeloid Leukemia, MECOM rearrangementAcute Myeloid Leukemia, MNX1 rearrangementAcute Myeloid Leukemia, NOSAcute Myeloid Leukemia, NPM1 alterationAcute Myeloid Leukemia, NUP98 rearrangementAcute Myeloid Leukemia, PICALM-MLLT10Acute Myeloid Leukemia, RBM15-MKL1Acute Myeloid Leukemia, RUNX1-RUNX1T1Acute Myeloid Leukemia, RUNX1-RUNX1T1 likeAcute Myeloid Leukemia, UBTF tandem duplicationAcute Myelomonocytic LeukemiaAcute Myelomonocytic Leukemia, KMT2A rearrangementAcute Myelomonocytic Leukemia, NPM1 alterationAcute Monoblastic/Monocytic Leukemia, KMT2A rearrangementAcute Promyelocytic Leukemia, PML-RARAChronic Neutrophilic LeukemiaTherapy-Related Acute Myeloid LeukemiaTherapy-Related Myelodysplastic SyndromeTherapy-Related Myeloid NeoplasmBTSTHMGCTCHPLEMBBEPDYGLMMNGTNGLTOBTPINEALSELRADRNBLUTBONEBWLEYEHANKIDLIVLUNGOSTOVFTPANPNSSKNSTISTHYMTHYRLYMPHMYELOHMBMGCTBYSTMGCTOGCTOYSTYSTPACPPCPCCPPATRTEMBTETMRMBLPNETAPEAPEPFEPMTNOSEPMTPFEPMTSTEPMTSUMEPMSTMPEMPEFVMPEPFASTRDIFGENCGGNOSMNGANGLCNCDIADIGGLNOSHGGTHGNETLGGNTLGNETANMBTNOSCEFTCICCICRSBHGCSIMTFETCR...MBTPATPBLPINCPINTPPTPPTIDPTPRACPGACAACCACTUMPPHCMRTBABCAOSLCHBLCHDMCHOSCHSEWSGCTBGICTMCHSMOOBOOOSOSOSGINETGISTIMTSSSRCCACLGRBLACYCAOTMUCCMYECNPCNTKPADASBLSGATCCSKCMNEAMLJGCTJXGLGORTMRTPRCCRCCWTWTBHBHCCHFNHMRTLUESLIMTLCNOSRTNOSSCUPMAOSCSTSLCTPANETSPNGNBLLGPNSTMPNSTNBLNFIBNMCSCHWANASPZMNASPZNCMLNDFSPMELMLNNMMELSCCNOSSKCMCRTC...SPZMNRSTTRMSMTHYMNIFTPNTHPSETTLETFAPHTHFOTHHCTHMETHPAALLNOSBALLNHLTALLAMLCMLMDSMPNMSTMPNADCTALALAULAULKMT2ABCUPESOPMPALTNOSRDDATRTSHHATRTTYRAMBLAMBLNWSG...AMBLNWSG...AMBLSHHDMBLSHHMBENSHHMBLG3MBLG4MBLSHHMBLWNTAASTRAOASTDASTRDIPGGBHGGNOSOASTODGAGNGAPXADNTGNGLGGNOSPASTPMAPXAADNOSAFHAFIBSASPSBCSCCSDESDSRCTEPISESSTFMSFMTFUPGCFIBHGSIFSIMTLBLLFBRLGMNLIPOMPCPGNGRCSNOSSARCNOSSCNSCSNOSSCYSYNSURCSARMSBERMSERMSMEMRMSNOSSCRMSSCSRMSBALLBCRA...BALLBCRA...BALLCRLF...BALLDUX4...BALLDUX4...BALLETV6...BALLETV6...BALLHLFBALLHYPE...BALLHYPOBALLIAMP...BALLIGHC...BALLIKZF...BALLKMT2...BALLMEF2...BALLMYCBALLNOSBALLNUTM...BALLPAX5BALLPAX5...BALLTCF3...BALLZNF3...BALLZNF3...ALCLALCLALKPBLBLLBCRAB...BLLNOSBLLTCF3H...BLLTCF3P...DLBCLNOSEMZLFLHGBCLMBNTLLLMO1TLLNKX2TLLNOSTLLTAL1TALLBCL1...TALLHOXATALLLMO2TALLNKX2TALLNOSTALLSPI1TALLTAL1TALLTAL2TALLTLX1TALLTLX3AMKLAMKLCBFA...AMKLKMT2...AMKLRBM1...AMLCBFA2...AMLCBFBM...AMLCBFNO...AMLCEBPAAMLDEKNU...AMLETSAMLGATA1AMLHOXAMLKAT6AAMLKMT2AAMLMECOMAMLMNX1AMLNOSAMLNPM1AMLNUP98AMLPICAL...AMLRBM15...AMLRUNX1...AMLRUNX1...AMLUBTFAMMLAMMLKMT2...AMMLNPM1AMOLKMT2...APLPMLRA...CNLTAMLTMDSTMN EpigeneticComing Soon Histology549 samples Expression3432 samples Mutational Signatures1843 samples Variants5467 samples