methyl-life.com
Open in
urlscan Pro
188.114.97.3
Public Scan
URL:
https://methyl-life.com/
Submission: On December 04 via manual from AU — Scanned from NL
Submission: On December 04 via manual from AU — Scanned from NL
Form analysis
4 forms found in the DOM/search
<form class="search_form" role="search" action="/search" tp-global-watched="true">
<input class="form-control" type="search" name="q" placeholder="What you are looking for?" aria-label="Search">
<button class="btn" type="submit">
<i class="fa fa-search" aria-hidden="true"></i>
</button>
</form>
GET /search
<form action="/search" method="get" id="example" class="search-bar search-bar--modal" role="search" tp-global-watched="true">
<input type="text" name="q" value="" placeholder="What are you looking for?" class="input-group-field" aria-label="What are you looking for?">
<span class="input-group-btn">
<button type="submit" class="btn icon-fallback-text">
<i class="fa fa-search" aria-hidden="true"></i>
<span class="fallback-text">Search</span>
</button>
</span>
</form>
POST
<form id="sca-qv-add-item-form" method="post" tp-global-watched="true">
<!-- Begin product options ! DON'T PUT CONTENT HERE!-->
<div class="sca-qv-product-options">
<!-- -------------------------- -->
<div id="sca-qv-variant-options" class="sca-qv-optionrow">
<!-- variant options of product ! DON'T PUT CONTENT HERE!-->
</div>
<!-- -------------------------- -->
<div class="sca-qv-optionrow">
<label>Quantity</label>
<input id="sca-qv-quantity" min="1" type="number" name="quantity" value="1">
</div>
<!-- -------------------------- -->
<div class="sca-qv-optionrow">
<p id="sca-qv-unavailable" class="sca-sold-out sca-qv-hidden">Unavailable</p>
<p id="sca-qv-sold-out" class="sca-sold-out sca-qv-hidden">Sold Out</p>
<input type="submit" class="sca-qv-cartbtn sca-qv-hidden sca-qv-cartbtn-config" value="ADD TO CART">
</div>
<!-- -------------------------- -->
<div id="sca-qv-addcart-msg" class="sca-qv-addcart-msg" style="position: absolute !important; margin-top:15px"></div>
</div>
<!-- End product options -->
</form>
POST /cart/update
<form method="post" action="/cart/update" id="currency_form" accept-charset="UTF-8" class="currency-selector small--hide" enctype="multipart/form-data" tp-global-watched="true"><input type="hidden" name="form_type" value="currency"><input
type="hidden" name="utf8" value="✓"><input type="hidden" name="return_to" value="/">
<input type="hidden" name="currency" value="CurrencyDrop">
</form>
Text Content
* Products Expand submenu Products Collapse submenu Products * Bundles Expand submenu Products Collapse submenu Products * Brain Protect Bundle * Cognitive Health Bundle * Mood Elevating Bundle * Mood Support Bundle * MTHFR Beginner's Bundle * Pregnancy Bundle * Sensitives Bundle * Methylfolate Only * Bioidentical B12 * Methyl B12 + Methylfolate * Magnesium * Multivitamins * Probiotics + Enzymes * Health Needs Expand submenu Health Needs Collapse submenu Health Needs * Brain Health * Energy Support * Gut Health * Heart Health * Immune Health * Mood Support * Nerve Health * Pregnancy * Research & Education Expand submenu Research & Education Collapse submenu Research & Education * A Doctor Explains * Help for MTHFR Newbies * Symptoms of MTHFR * Treating MTHFR * Types of Methylfolate * What is MTHFR? * What Should I Order? * Recent Posts * B-12 * Children * Fertility/ Pregnancy/ Women's Health * Health Issues * Mental Health * Methylfolate Facts * MTHFR Genetics * Staying Healthy * Vital Nutrients * About Expand submenu About Collapse submenu About * About Us * Affiliates * Contact Us * Medical Reviewers * Wholesale * * Log In * Create Account Create wholesale account * Manage Subscriptions FREE HOLIDAY SHIPPING (Nov 1 - Jan 31) | Starting Feb 1, 2024 -> FREE SHIPPING on orders over $100. X Site navigation * Log In * * USDGBPEURCADAUDINRJPYAEDAFNALLAMDANGAOAARSAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCDFCHFCLPCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPIQDIRRISKJEPJMDJODKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNTDNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSPLSRDSTDSVCSYPSZLTHBTJSTMMTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVEFVNDVUVWSTXAFXAGXAUXBTXCDXDRXOFXPDXPFXPTYERZARZMKZMWZWD USD * USD * GBP * EUR * CAD * AUD * INR * JPY * AED * AFN * ALL * AMD * ANG * AOA * ARS * AWG * AZN * BAM * BBD * BDT * BGN * BHD * BIF * BMD * BND * BOB * BRL * BSD * BTN * BWP * BYN * BYR * BZD * CDF * CHF * CLP * CNY * COP * CRC * CUC * CUP * CVE * CZK * DJF * DKK * DOP * DZD * EGP * ERN * ETB * FJD * FKP * GEL * GGP * GHS * GIP * GMD * GNF * GTQ * GYD * HKD * HNL * HRK * HTG * HUF * IDR * ILS * IMP * IQD * IRR * ISK * JEP * JMD * JOD * KES * KGS * KHR * KMF * KPW * KRW * KWD * KYD * KZT * LAK * LBP * LKR * LRD * LSL * LYD * MAD * MDL * MGA * MKD * MMK * MNT * MOP * MRO * MUR * MVR * MWK * MXN * MYR * MZN * NAD * NGN * NIO * NOK * NPR * NTD * NZD * OMR * PAB * PEN * PGK * PHP * PKR * PLN * PYG * QAR * RON * RSD * RUB * RWF * SAR * SBD * SCR * SDG * SEK * SGD * SHP * SLL * SOS * SPL * SRD * STD * SVC * SYP * SZL * THB * TJS * TMM * TMT * TND * TOP * TRY * TTD * TVD * TWD * TZS * UAH * UGX * UYU * UZS * VEF * VND * VUV * WST * XAF * XAG * XAU * XBT * XCD * XDR * XOF * XPD * XPF * XPT * YER * ZAR * ZMK * ZMW * ZWD * Products * Bundles * Brain Protect Bundle * Cognitive Health Bundle * Mood Elevating Bundle * Mood Support Bundle * MTHFR Beginner's Bundle * Pregnancy Bundle * Sensitives Bundle * Methylfolate Only * Bioidentical B12 * Methyl B12 + Methylfolate * Magnesium * Multivitamins * Probiotics + Enzymes * Health Needs * Brain Health * Energy Support * Gut Health * Heart Health * Immune Health * Mood Support * Nerve Health * Pregnancy * Research & Education * A Doctor Explains * Help for MTHFR Newbies * Symptoms of MTHFR * Treating MTHFR * Types of Methylfolate * What is MTHFR? * What Should I Order? * Recent Posts * B-12 * Children * Fertility/ Pregnancy/ Women's Health * Health Issues * Mental Health * Methylfolate Facts * MTHFR Genetics * Staying Healthy * Vital Nutrients * About * About Us * Affiliates * Contact Us * Medical Reviewers * Wholesale Your cart Close Cart Use left/right arrows to navigate the slideshow or swipe left/right if using a mobile device WE ARE THE SOLUTION TO YOUR MTHFR SYMPTOM SUPPORT Learn More Our passion: Empower those with MTHFR to thrive with vitality. Reclaim your spark with our pure, practitioner-recommended, preservative-free supplements that promote optimal health. FEATURED FAVORITES Methyl-Life® has set the industry standard for pure, high-potency L-methylfolate, and offers a range of superior health supplements catering to the needs of those with MTHFR gene mutations as well as those seeking the highest-quality folate available. Statistically about half of the population have genetic variations that reduce the ability of the MTHFR enzyme to convert folic acid to its usable form, methylfolate. See more products Methylfolate 15 mg L-Methylfolate 7.5mg+ B12 B-Methylated-II - Methylfolate + Methyl B12 L-Methylfolate 15mg+ B12 METHYL-LIFE® L-METHYLFOLATE SUPPLEMENTS SHOP SUPPORTS AND BENEFITS LIFE WITH MTHFR Consider Methyl-Life® products to support your loved ones and minimize deficiencies How do I support MTHFR? If you've been newly diagnosed with an MTHFR mutation or are just looking to take some concrete action that can better support your health and improve your quality of life, check out our 6 Helpful Steps for Treating MTHFR page for some ideal guidelines. A Doctor Educates on MTHFR Dr. Neil Rawlins presents his 4-part video seminar on MTHFR, methylfolate and how to manage challenging genetic factors affecting folate metabolism, neurotransmitter production (i.e. serotonin, dopamine, norepinephrine), methylation, homocysteine, detoxification and more. Naturopathic Consult Services Consider booking one of our Naturopathic Practitioner Consultation options. Our Naturopath can review your personal medical history, genetics and recent blood tests and provide either: 1. an email response to one of your health issues OR 2. a 60-minute online, real-time video consult call addressing your top health concerns WE HAVE THE SPECIFIC NUTRIENTS YOU NEED WHEN DEALING WITH MTFHR * Methyfolate & Cofactors * B12 & B Vitamins * Biotics & Enzymes * Support & Nutriment Blends METHYLFOLATE & COFACTORS: Elevate your health with Methylfolate and Cofactors: Vital for optimal energy, mood, and DNA support. Overcome MTHFR and discover the power of wellness today! Learn More B12 & B VITAMINS: Get your vitality back with B12 and B vitamins: Vital for energy, metabolism, and nerve function. They support red blood cells, DNA synthesis, and overall well-being. Learn More BIOTICS & ENZYMES: Optimize your health with Probiotics and Enzymes: Vital for aiding improved digestion, boosting your gut’s health, nutrient absorption, and helping you to achieve overall well-being. Learn More SUPPORT & NUTRIMENT BLENDS: Get your spark back with essential Vitamins & Nutrients that vitally support immune health, mood, cognitive function, and improved well-being. Learn More REVITALIZE YOUR HEALTH AND RECLAIM YOU! If you have MTHFR, L-Methylfolate is the key to getting your spark back. Learn why we started Methyl-Life® and why our folate is the purest and most effective for MTHFR. Learn More WHERE SCIENCE AND INTEGRITY INTERSECT. Understand Methyl-Life’s® manufacturing, rigorous testing, and potency standards. Learn More OUR MISSION People with MTHFR have varying issues and needs, and our goal is to significantly enhance the quality of life of those searching for a solution. We will help alleviate your frustration, serve as a trusted resource, and most importantly, put you in a healthier place for life. See why our L-Methylfolate is purest on the planet JOIN OUR WHOLESALE PROGRAM Methyl-Life® offers wholesale accounts to doctors or businesses reselling our products. If you are a doctor or a business, just click below to register with us for a wholesale account. We look forward to having you on our team! Open a wholesale account -------------------------------------------------------------------------------- CONTACT OFFICE HOURS (PST) Mon-Fri - 8am -7pm EMAIL US (571) 308-2172 * * * * * ABOUT * Methyl-Life® SUPPORT * FAQs * Returns * Shipping Policy * International Customers * Privacy Policy * Terms of Service * Reseller Registration * Wholesale Login COMMUNITY * Professional Writers * Customer Testimonials LEARN * Our Manufacturing Process * What is MTHFR? * A Doctor Explains MTHFR * Comparing L-Methylfolates * L-Methylfolate dosage * Methylation Protocol Methyl-Life.com | © 2011-2023 All Rights Reserved | Disclaimer: The statements on this website have not been evaluated by the Food and Drug Administration. Our products are not intended to diagnose, treat, cure or prevent any disease. Search * Choosing a selection results in a full page refresh. * Press the space key then arrow keys to make a selection. Sale View full product details → Quantity Unavailable Sold Out X You must login before you make a recurring purchase. Login Reviews