digiswiftamf.vipdigiswiftchannelkonfigvipdigiswiftvipamin.workers.dev
Open in
urlscan Pro
2606:4700:3031::6815:4757
Public Scan
Submission: On February 16 via api from US — Scanned from US
Summary
TLS certificate: Issued by E1 on February 14th 2024. Valid for: 3 months.
This is the only time digiswiftamf.vipdigiswiftchannelkonfigvipdigiswiftvipamin.workers.dev was scanned on urlscan.io!
urlscan.io Verdict: No classification
Domain & IP information
IP Address | AS Autonomous System | ||
---|---|---|---|
1 | 2606:4700:303... 2606:4700:3031::6815:4757 | 13335 (CLOUDFLAR...) (CLOUDFLARENET) | |
1 | 1 |
ASN13335 (CLOUDFLARENET, US)
digiswiftamf.vipdigiswiftchannelkonfigvipdigiswiftvipamin.workers.dev |
Apex Domain Subdomains |
Transfer | |
---|---|---|
1 |
workers.dev
digiswiftamf.vipdigiswiftchannelkonfigvipdigiswiftvipamin.workers.dev |
1 KB |
1 | 1 |
Domain | Requested by | |
---|---|---|
1 | digiswiftamf.vipdigiswiftchannelkonfigvipdigiswiftvipamin.workers.dev | |
1 | 1 |
This site contains no links.
Subject Issuer | Validity | Valid | |
---|---|---|---|
vipdigiswiftchannelkonfigvipdigiswiftvipamin.workers.dev E1 |
2024-02-14 - 2024-05-14 |
3 months | crt.sh |
This page contains 1 frames:
Primary Page:
https://digiswiftamf.vipdigiswiftchannelkonfigvipdigiswiftvipamin.workers.dev/
Frame ID: 44AE9BB76C8DAEA8C7F5849FB7478998
Requests: 1 HTTP requests in this frame
0 Outgoing links
These are links going to different origins than the main page.
Redirected requests
There were HTTP redirect chains for the following requests:
1 HTTP transactions
Method Protocol |
Resource Path |
Size x-fer |
Type MIME-Type |
||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
GET H2 |
Primary Request
/
digiswiftamf.vipdigiswiftchannelkonfigvipdigiswiftvipamin.workers.dev/ |
1 KB 1 KB |
Document
text/plain |
||||||||||||||||||||||||||||||||||||||||||||||
General
Request headers
Response headers
|
Verdicts & Comments Add Verdict or Comment
0 JavaScript Global Variables
These are the non-standard "global" variables defined on the window object. These can be helpful in identifying possible client-side frameworks and code.
0 Cookies
Cookies are little pieces of information stored in the browser of a user. Whenever a user visits the site again, he will also send his cookie values, thus allowing the website to re-identify him even if he changed locations. This is how permanent logins work.
Indicators
This is a term in the security industry to describe indicators such as IPs, Domains, Hashes, etc. This does not imply that any of these indicate malicious activity.
digiswiftamf.vipdigiswiftchannelkonfigvipdigiswiftvipamin.workers.dev
2606:4700:3031::6815:4757
614dbeabcc8cf351cf0febcf11ff8dee010bc8c428983e0069e44fd91ee6182e