www.temptations.net.co
Open in
urlscan Pro
54.154.42.22
Public Scan
Submitted URL: http://www.temptations.net.co/
Effective URL: https://www.temptations.net.co/
Submission: On September 04 via api from US — Scanned from DE
Effective URL: https://www.temptations.net.co/
Submission: On September 04 via api from US — Scanned from DE
Form analysis
1 forms found in the DOMGET https://www.temptations.net.co/index.aspx?pageid=1319323
<form action="https://www.temptations.net.co/index.aspx?pageid=1319323" method="get"><input name="pageid" id="pageid" type="hidden" value="1319323"><input name="chainID" id="chainID" type="hidden" value="142521"><input id="txtQuickSearch"
aria-label="search" type="text" name="txtQuickSearch" placeholder="search..." value="">
<input id="search_button" aria-label="Submit search" type="submit" value="Search" class="icon-search">
</form>
Text Content
0 items Sign In | GBPAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL * Home * Our Shipping Rates * All About Us * Basket * How to make things * Contact * Store Links ▼ * Special Offers * View Products ▼ * SPECIAL OFFERS * WEDDING BUTTONHOLES * Garters * Wedding Decorations * Parent Category * Parent Category * HOUSE AND HOME * Cushion Covers * Silk Flowers & Vases * Table Runners * CUP CAKE & GIFT BOXES * GIRLS ACCESORIES * WOMENS ACCESSORIES * Scarves * Handbags * FANCY HAIR COMBS * TEMPTATIONS FLOWERS * FASCINATORS * Customer Orders * TEMPTATIONS BAGS * FLORIST SUPPLIES * Wires & Tapes * PETALS * Ribbon & Pull Bows * Decorative Additions * Pins * Diamantie Decorative * Decorative Bows * Pearl & Diamontie Sprays * Jewellery * Findings * Earrings * Beads * House and Home * Prev * Next WELCOME TO TEMPTATIONS & FLOWERS FOR LOVE CLICK HERE FOR BARGAINS FREE DELIVERY CLICK HERE TO FIND OUT MORE FEATURED PRODUCTS Sale BLACK AND DIAMANTE EARRING £5.99 £2.10 Details Buy Sale GOLD AND DIAMANTE NECKLACE £5.99 £2.40 Details Buy Sale PURPLE EVENING BAG PURSE £12.00 £4.20 Details Buy Sale SATIN PINK EVENING BAG WITH DIAMA.. £17.99 £7.20 Details Buy Hot! 2 MTRS DIAMONTIE RIBBON 5 ROWS WIDE £2.00 Details Buy Sale RED PURSE £9.99 £4.00 Details Buy * Terms * Privacy * Free online shop uk © Temptations & Flowers for Love 2023 MODAL DIALOG TITLE Modal Dialog Content Cancel Ok Create a free online store Powered by freewebstore.com Get your free online store today - Be your own boss! freewebstore Got a great business idea? Get a free online store just like this one! What do I get? Hosted online store Unlimited products Domain & SSL checkout 24/7 support And more... Why freewebstore? 10+ years 650k stores created No card required Easy to create What's the catch? No catch 0% commission Free forever! Feature upgrades available Get Started i ? Free UK eCommerce websites - click here freewebstore