www.baitwize.co.uk
Open in
urlscan Pro
52.17.85.125
Public Scan
Submitted URL: http://www.baitwize.co.uk/
Effective URL: https://www.baitwize.co.uk/
Submission Tags: @phish_report
Submission: On October 25 via api from FI — Scanned from FI
Effective URL: https://www.baitwize.co.uk/
Submission Tags: @phish_report
Submission: On October 25 via api from FI — Scanned from FI
Form analysis
1 forms found in the DOMGET https://www.baitwize.co.uk/index.aspx?pageid=7161920
<form action="https://www.baitwize.co.uk/index.aspx?pageid=7161920" method="get"><input name="pageid" id="pageid" type="hidden" value="7161920"><input name="chainID" id="chainID" type="hidden" value="691028">
<div class="search" data-editor-type="search">
<input type="text" id="txtQuickSearch" name="txtQuickSearch" aria-label="search" placeholder="search">
<button aria-label="Submit search"><i class="fa fa-search" aria-hidden="true"></i></button>
</div>
</form>
Text Content
We're currently looking for - Bait Testers and Social Media Promoters to join our growing team. Got what it takes you reckon?? Drop us a line.. Cookie Policy This website uses cookies to ensure you get the best experience on our website. DeclineAllow cookies HomeCartContact Pro Cat Range Feedstimulants UK Amino acidsStimulants & Attraction Flavours & SweetenersProtein - BaseVitamins & EnzymesLiquids & oilsEssential oils & OleoresinsPop up mixes & dye'sUltra Trigger Pop UpsEssential Pack Holy Mackerel Rod Hutchinson H.A.H.L RangeLegend RangeLimited Edition Essential Oil RH Powdered StimsExclusive Blend Nutrabaits Liquid FoodsU.T.C.S Liquid FlavoursNature Identical Liquid FlavoursEssential OilsCajouser RangeMisc AdditivesPowdered Natural Extract Solar Tackle MIXMASTER LIQUIDS Fjuka Login / Register English FranceGermany GBP AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL Menu 0 items HomeCartContact Login / Register English FranceGermany GBP AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL 0 items Pro Cat Range Feedstimulants UK Amino acidsStimulants & Attraction Flavours & SweetenersProtein - BaseVitamins & EnzymesLiquids & oilsEssential oils & OleoresinsPop up mixes & dye'sUltra Trigger Pop UpsEssential Pack Holy Mackerel Rod Hutchinson H.A.H.L RangeLegend RangeLimited Edition Essential Oil RH Powdered StimsExclusive Blend Nutrabaits Liquid FoodsU.T.C.S Liquid FlavoursNature Identical Liquid FlavoursEssential OilsCajouser RangeMisc AdditivesPowdered Natural Extract Solar Tackle MIXMASTER LIQUIDS Fjuka Welcome to Baitwize Welcome Welcome to Baitwize we hope you find everything you're looking for. **Now Stocking the: Nutrabaits - Feedstimulants - Rod Hutchinson - Solar Tackle - Fjuka ** Powder/Meal Milk-Stim + Bait Additive £4.99 Add To Cart MILKSTIM + For those that remember the legendary Milk B+ that was so devastatingly effective through... Popup - Wafter Range NB1 Matching Popups 16mm £4.99 Add To Cart Matching NB1 Super Buoyant Popups 16mm Containing the same flavour profile as the feed bait version but... Boilie Range NB1 Milky Nut Boilie 1kg £8.50 Add To Cart Baitwize NB1 Shelflife Boilies 16mm Quite simplly an all season complete food source boilie comprising... Stimulants & Attraction Green Lipped Mussel ful.. £6.49 Add To Cart Greenshell Lipped Mussel full fat concentrate (GLM) 60% We believe that only the very best additives... Terminal Tackle BOILIE GUN WITCHES HAT .. £1.75 Add To Cart Description 1x yellow witches hat nozzles for Bait Guns - Extruders - Branded Cox. These can be cut to... Pro Cat Range Fluro Pro Cat Popup Range £7.99 Add To Cart Here we have a first for Baitwize our launch of the Pro Cat Catfish Popups Available in 24mm in a choice... Liquids Soluble Shrimp Extract .. £4.99 Add To Cart Shrimp Soluble Extract (SSE) (Feed / ABP CAT3) is a hydrolysed shrimp protein extract. It is in a viscous,... Flavours LactoseStim, sweet flav.. £5.29 Add To Cart LactoseStim A pure powdered flavour with a deep sweet fragrance of rich mother milk, eggs and taste of... Popular Products BOILIE GUN WITCHES HAT COX NOZZLES Terminal Tackle Popup Corn Style Toppers Popup - Wafter Range Reaction Range Feed Boilies Boilie Range src="https://www.facebook.com/tr?id=487643729119926&ev=PageView&noscript=1" /> src="https://www.facebook.com/tr?id=487643729119926&ev=PageView&noscript=1" /> New Products 8mm Wafter Hookbaits Free Post Popup - Wafter Range £4.99 Pillow - Quad Style 1kg Hookbaits Popup - Wafter Range £25.00 Baitwize Liquid Bait Preserver 1ltr Liquids £9.99 Newsletter Subscribe Follow Us Instagram.AboutTermsPrivacySitemap © 2023. Baitwize | ie9+ | Free sell online uk Create a free online store Powered by freewebstore.com Get your free online store today - Be your own boss! freewebstore Got a great business idea? Get a free online store just like this one! What do I get? Fully loaded webstore Unlimited products Domain & SSL checkout 24/7 support And more... Why freewebstore? 15+ years 1 million stores created No card required Easy to create What's the catch? Nope, no catch 0% commission Free forever! Premium upgrades available Get Started i ? Free online shops uk - click here freewebstore This store has been put on vacation by the store owner Cancel Ok