www.rootsandwingsboutiquehandmade.com
Open in
urlscan Pro
54.154.42.22
Public Scan
Submitted URL: http://www.rootsandwingsboutiquehandmade.com/
Effective URL: https://www.rootsandwingsboutiquehandmade.com/
Submission: On December 02 via api from US — Scanned from DE
Effective URL: https://www.rootsandwingsboutiquehandmade.com/
Submission: On December 02 via api from US — Scanned from DE
Form analysis
1 forms found in the DOMGET https://www.rootsandwingsboutiquehandmade.com/index.aspx?pageid=7015454
<form action="https://www.rootsandwingsboutiquehandmade.com/index.aspx?pageid=7015454" method="get"><input name="pageid" id="pageid" type="hidden" value="7015454"><input name="chainID" id="chainID" type="hidden" value="677751">
<div class="search" data-editor-type="search">
<div class="desktop_title" data-lang="search">search</div>
<input type="text" placeholder="product search..." id="txtQuickSearch" name="txtQuickSearch">
</div>
</form>
Text Content
Welcome to Roots And Wings Boutique $0.00 USD AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL search Pages Roots & Wings BoutiqueAbout Roots & WingsSpecial OffersCartContactAmazon Influencer Categories ChristmasCowlsDishclothEarwarmersScarvesShawlsSuper ScarfWashclothWashcloths/DishclothsScarf & Earwarmer Set ROOTS & WINGS BOUTIQUE Roots & Wings Boutique - Where Tradition Meets Style WINTER SALE!!! . Farmhouse Evergreen Scarf $48.00 Farmhouse Evergreen Shawl $75.00 Aspen Scarf & Aspen Fable Earwarmer Set $75.00 Autumn Leaves Scarf $48.00 Magnolia River Shawl $75.00 Retro Holiday Scarf $48.00 Retro Fable Earwarmer $21.25 Cotton Candy Scarf $48.00 Cookies & Cream Super Scarf & Earwarmer $75.00 Circus Fable Earwarmer $21.25 Golden Fable Earwarmer $21.25 Farmhouse Christmas Shawl $93.75 Red Velvet Scarf & Earwarmer Bundle / Set $75.00 Red Sparkle Earwarmer $21.25 ROOTS AND WINGS BOUTIQUE STORE LINKS Terms Privacy Sitemap NEWSLETTER © 2023. Roots And Wings Boutique | ie9+ | Free ecommerce templates MODAL DIALOG TITLE Modal Dialog Content Cancel Ok Create a free online store Powered by freewebstore.com Get your free online store today - Be your own boss! freewebstore Got a great business idea? Get a free online store just like this one! What do I get? Fully loaded webstore Unlimited products Domain & SSL checkout 24/7 support And more... Why freewebstore? 15+ years 1 million stores created No card required Easy to create What's the catch? Nope, no catch 0% commission Free forever! Premium upgrades available Get Started i ? Start your own online business today - click here freewebstore