ngodarpan.gov.in
Open in
urlscan Pro
164.100.161.196
Public Scan
URL:
https://ngodarpan.gov.in/index.php/search/
Submission: On December 11 via manual from IN — Scanned from IL
Submission: On December 11 via manual from IN — Scanned from IL
Form analysis 10 forms found in the DOM
<form role="form" id="loginForm" data-toggle="validator" class="shake" novalidate="true">
<input type="hidden" id="csrf_test_name" name="csrf_test_name" value="1103cb0f557410bc566e558991fdc124">
<input type="hidden" name="key" id="key" value="mAAed7pGWWfxnAbvX8o=">
<div class="form-group">
<div class="input-group">
<div class="input-group-addon"><i class="fa fa-user"></i></div>
<input type="text" autocomplete="off" class="form-control" id="login_id" placeholder="Enter Your Login ID" data-content="Enter Registered NGO Pan, Email, Mobile you have created at the time of registration" data-placement="top"
data-trigger="hover" data-toggle="popover" required="" data-error="Please Enter Valid Login ID!" maxlength="50" onkeyup="chkvaliduser(this.value);" data-original-title="" title="">
<a href="#" style="position: absolute; margin: 9px 0px 0px 11px;"><span class="glyphicon glyphicon-info-sign" data-toggle="tooltip" data-original-title="Please enter Registered NGO Pan, Email, Mobile as Login ID!"></span></a>
</div>
<div class="help-block with-errors" style="margin-left:-175px;"></div>
<div style="margin-left:-125px;display:none;color:#a94442;" class="help-block">
<ul class="list-unstyled">
<li>UserID or password is Invalid.</li>
</ul>
</div>
<div style="margin-left:-6px;display:none;color:#a94442;" class="login_id_error help-block">
<ul class="list-unstyled">
<li>Please Enter Valid Login ID, valid characters are a-z, A-Z, 0-9, the underscore (_), and the dash (-). Spaces are not permitted.</li>
</ul>
</div>
<span class="help-block has-error" id="email-error"></span>
</div>
<div class="form-group">
<div class="input-group">
<div class="input-group-addon"><i class="fa fa-lock"></i></div>
<input type="password" autocomplete="off" class="form-control" id="password" placeholder="Password" data-content="Enter Password you have created by the link sending by us" data-placement="top" maxlength="40" data-trigger="hover"
data-toggle="popover" required="" data-error="Please Enter Password!" onkeyup="chkvalidpass(this.value);" data-original-title="" title="">
<a href="#" style="position: absolute; margin: 9px 0px 0px 11px;"><span class="glyphicon glyphicon-info-sign" data-toggle="tooltip" data-original-title="Please enter Password"></span></a>
</div>
<div class="help-block with-errors" style="margin-left:-194px;"></div>
<div style="margin-left:-125px;display:none;color:#a94442;" class="password_error help-block">
<ul class="list-unstyled">
<li>Please enter valid Password!</li>
</ul>
</div>
<span class="help-block has-error" id="password-error"></span>
</div>
<div class="form-group">
<div id="captchaimagehere" style="float: left; margin-bottom: 15px;"><img src="https://ngodarpan.gov.in/captcha/1733904058.1526.jpg" style="width: 220; height: 40; border: 0;" alt=" "></div>
<div class="col-md-4"><a href="javascript:void(0)" class="refresh" style="margin-right:50px;"><img width="40px" height="40px" id="ref_symbol" src="https://ngodarpan.gov.in/assets/images/reload.png"></a></div>
</div>
<div class="form-group">
<input type="text" pattern="^[A-z0-9]{1,}$" autocomplete="off" class="form-control" placeholder="Enter Security Code Display Above" required="" data-error="Please Enter Valid Security Code!" id="captcha" maxlength="8" value="">
<div class="help-block with-errors" style="margin-left:-172px;"></div>
<div style="margin-left:-52px;display:none;color:#a94442;" class="captcha_error help-block">
<ul class="list-unstyled">
<li>Please Enter Valid Security Code OR Close Window and Try Again!</li>
</ul>
</div>
</div>
<div class="login_exist alert alert-danger" role="alert" style="display:none;">UserID or password is Invalid </div>
<button type="button" style="display:none;float:left; height: 25px;background-color: #337ab7;border-color: #2e6da4;color: #fff;margin-bottom:20px;" class="btn btn-primary btn-xs forget-link">Forget Password</button>
<button type="button" style="display:none;float:right; height: 25px;background-color: #337ab7;border-color: #2e6da4;color: #fff;" class="btn btn-primary btn-xs login-otp-link">Login Via OTP</button>
<input type="hidden" id="sdfsdfdfdsff" value="" name="sdfsdfdfdsff">
<button type="submit" id="login_btn" class="btn btn-block bt-login has-spinner" data-loading-text="Signing In...." style="pointer-events: all; cursor: pointer;">Sign In</button>
<div class="clearfix"></div>
</form><form role="form" id="regForm" data-toggle="validator" class="shake" novalidate="true">
<input type="hidden" name="" value="">
<legend>Step 1 of 3</legend>
<font color="red"><span id="signup_otp_error"></span></font>
<div class="form-group">
<label for="name" style="margin: 0px 0px 13px -217px;" class="control-label">Name of NGO/VO</label>
<div class="input-group">
<div class="input-group-addon"><i class="fa fa-user"></i></div>
<input type="text" onblur="chkngoname(this.value);" required="" autocomplete="off" class="form-control" id="ngo_name" placeholder="Enter Ngo Name" data-minlength="2" maxlength="200"
data-content="Contain upto 200 characters & valid characters are a-z, A-Z, 0-9,+,&,., (, -,_, ),/,! " data-placement="top" data-trigger="hover" data-toggle="popover" pattern="[a-zA-Z0-9:.)(&\}\+\/\s\,\!\'-_]+"
data-error="Please Enter Valid Ngo Name!" data-original-title="" title="">
<a href="#" style="position: absolute; margin: 9px 0px 0px 11px;"><span class="glyphicon glyphicon-info-sign" data-toggle="tooltip" data-original-title="Only Characters a-z, A-Z, 0-9,+,&,., (, -,_, ),/, ! are allowed"></span></a>
</div>
<div class="help-block with-errors" style="margin-left:-159px;"></div>
<div style="margin-left:-125px;display:none;color:#a94442;" class="db_check_ngo help-block">
<ul class="list-unstyled">
<li>Ngo Name Already exist in Records!</li>
</ul>
</div>
<div style="margin-left:-125px;display:none;color:#a94442;" class="ngo_name_empty help-block">
<ul class="list-unstyled">
<li>Please Enter Ngo Name!</li>
</ul>
</div>
<div style="margin-left:-36px;display:none;color:#a94442;" class="ngo_name_valid help-block">
<ul class="list-unstyled">
<li>Please Enter valid Ngo Name with valid alphabets Characters</li>
</ul>
</div>
<div style="margin-left:-125px;display:none;color:#a94442;" class="ngo_name_char_length help-block">
<ul class="list-unstyled">
<li>Please Enter valid Ngo Name length</li>
</ul>
</div>
<span class="help-block has-error" data-error="0" id="username-error"></span>
</div>
<div class="form-group">
<label for="name" style="margin: 0px 0px 13px -128px;" class="control-label">Contact Person Mobile Number</label>
<div class="input-group">
<div class="input-group-addon"><i class="fa fa-mobile"></i></div>
<input type="text" required="" autocomplete="off" class="form-control" id="mobile" placeholder="Enter Mobile Number" maxlength="10"
data-content="Please enter a valid 10-digit mobile number without any country code. You will receive an OTP at given mobile number." data-placement="top" data-trigger="hover" data-toggle="popover" pattern="[789][0-9]{9}"
data-error="Please Enter Valid Mobile Number!" data-original-title="" title="">
<a href="#" style="position: absolute; margin: 9px 0px 0px 11px;"><span class="glyphicon glyphicon-info-sign" data-toggle="tooltip" data-original-title="Only Numeric Character Are allowed"></span></a>
</div>
<div class="help-block with-errors" style="margin-left:-132px;"></div>
<div style="margin-left:-125px;display:none;color:#a94442;" class="db_check_mobile help-block">
<ul class="list-unstyled">
<li>Mobile Already exist in Records!</li>
</ul>
</div>
<div style="margin-left:-125px;display:none;color:#a94442;" class="mobile_empty help-block">
<ul class="list-unstyled">
<li>Please enter Mobile Number!</li>
</ul>
</div>
<div style="margin-left:-11px;display:none;color:#a94442;" class="mobile_valid help-block">
<ul class="list-unstyled">
<li>Enter valid Mobile Number that contains valid 10 Numeric Character without "0" & "91"!</li>
</ul>
</div>
<span class="help-block has-error" data-error="0" id="username-error"></span>
</div>
<div class="form-group">
<label for="name" style="margin: 0px 0px 13px -191px;" class="control-label">Contact Person Email</label>
<div class="input-group">
<div class="input-group-addon"><i class="fa fa-at"></i></div>
<input type="text" required="" pattern="\w+([\.-]?\w+)*@\w+([\.-]?\w+)*(\.\w{2,3})+" autocomplete="off" class="form-control" id="email" placeholder="Enter Email"
data-content="Please enter a valid email id.You will receive an OTP at given Email id" data-placement="top" data-trigger="hover" data-toggle="popover" data-error="Please Enter valid Email!" data-original-title="" title="">
<a href="#" style="position: absolute; margin: 9px 0px 0px 11px;"><span class="glyphicon glyphicon-info-sign" data-toggle="tooltip" data-original-title="Enter Valid Email, Example: username@domain.com"></span></a>
</div>
<div class="help-block with-errors" style="margin-left:-198px;"></div>
<div style="margin-left:-125px;display:none;color:#a94442;" class="db_check_email help-block">
<ul class="list-unstyled">
<li>Email Already exist in Records!</li>
</ul>
</div>
<div style="margin-left:-125px;display:none;color:#a94442;" class="email_empty help-block">
<ul class="list-unstyled">
<li>Please Enter Email!</li>
</ul>
</div>
<div style="margin-left:-125px;display:none;color:#a94442;" class="email_valid help-block">
<ul class="list-unstyled">
<li>Please Enter Valid Email!</li>
</ul>
</div>
<span class="help-block has-error" data-error="0" id="email-error"></span>
</div>
<div class="form-group">
<div id="captchaimagehere11" style="float: left; margin-bottom: 15px;"><img src="https://ngodarpan.gov.in/captcha/1733904058.3877.jpg" style="width: 220; height: 40; border: 0;" alt=" "></div>
<div class="col-md-4"><a href="javascript:void(0)" class="refresh11" style="margin-right:50px;"><img width="40px" height="40px" id="ref_symbol" src="https://ngodarpan.gov.in/assets/images/reload.png"></a></div>
</div>
<div class="form-group">
<input type="text" required="" pattern="^[A-z0-9]{1,}$" autocomplete="off" class="form-control" placeholder="Enter Security Code Display Above" data-error="Please Enter Valid Security Code!" id="captcha11" maxlength="8" value="">
<div class="help-block with-errors" style="margin-left:-140px;"></div>
<div style="margin-left:-2px;display:none;color:#a94442;" class="captcha_error11 help-block">
<ul class="list-unstyled">
<li>Please Enter Valid Security Code OR Close Window and Try Again!</li>
</ul>
</div>
</div>
<div>
<ul style="font-size:11px; font-weight:600; text-align : left; list-style-type:none ">
<li>- There are total 3 Steps for Creating an Account at Portal</li>
<li>- Step 1 : Input NGO / Entity Name exactly similar as given in PAN Card </li>
<li>- Email and Mobile number should be working and accessible for OTPs. </li>
<li> - Step 2: PAN of NGO / Entity need to be given which will be matched with Name of NGO / Entity given at Step 1 </li>
<li> - Step 3: Password can only be created when Step 2 is passed successfully </li>
</ul>
</div>
<button type="submit" id="register_btn" class="btn btn-block bt-login has-spinner" data-loading-text="Registering...." style="pointer-events: all; cursor: pointer;">Submit</button>
<div class="clearfix"></div>
</form><form role="form" id="regForm2" style="display:none;" data-toggle="validator" class="shake" novalidate="true">
<input type="hidden" name="csrf_test_name" value="1103cb0f557410bc566e558991fdc124">
<input type="hidden" id="hidden_mob_otp" value="" name="hidden_mob_otp">
<input type="hidden" id="hidden_email_otp" value="" name="hidden_email_otp">
<legend>Step 2 of 3</legend>
<div class="form-group">
<label for="name" style="margin: 0px 0px 13px -217px;" class="control-label">Name of NGO/VO</label>
<div class="input-group">
<div class="input-group-addon" id="dp1Icon"><i class="fa fa-user"></i></div>
<span class="input-group-addon blocked hidden" id="dp1Icon_blocked"><i class="fa fa-user"></i></span>
<input type="text" autocomplete="off" class="form-control" id="ngo_name2">
</div>
</div>
<div class="form-group">
<label for="name" style="margin: 0px 0px 13px -128px;" class="control-label">Contact Person Mobile Number</label>
<div class="input-group">
<div class="input-group-addon" id="dp2Icon"><i class="fa fa-mobile"></i></div>
<span class="input-group-addon blocked hidden" id="dp2Icon_blocked"><i class="fa fa-mobile"></i></span>
<input type="text" autocomplete="off" class="form-control" id="mobile2" value="">
</div>
</div>
<div class="form-group">
<label for="name" style="margin: 0px 0px 13px -191px;" class="control-label">Contact Person Email</label>
<div class="input-group">
<div class="input-group-addon" id="dp3Icon"><i class="fa fa-at"></i></div>
<span class="input-group-addon blocked hidden" id="dp3Icon_blocked"><i class="fa fa-at"></i></span>
<input type="email" class="form-control" id="email2" value="">
</div>
</div>
<div class="form-group">
<!-- <span id="dummy_otp_mobile"></span> -->
<label for="name" style="margin: 0 0 12px -261px;" class="control-label">Mobile OTP</label>
<!-- <div class="input-group"> -->
<!-- <div class="input-group-addon"><i class="fa fa-mobile"></i></div> -->
<input type="text" pattern="\d*" autocomplete="off" class="form-control" id="mob_otp" onkeyup="clearerror(this.value);" placeholder="Enter an Mobile OTP" name="mobile_otp" maxlength="6"
data-content="Please enter a valid OTP Recieved on your mobile number given in step 1." data-placement="top" data-trigger="hover" data-toggle="popover" required="" data-error="Please Enter Valid Mobile OTP!" data-original-title="" title="">
<a href="#" style="position: absolute; margin: -28px 0 0 180px;"><span class="glyphicon glyphicon-info-sign" data-toggle="tooltip" data-original-title="Please Enter OTP you recieved on mobile number you have entered in step 1"></span></a>
<div style="margin-left:-11px;display:none;color:#a94442;" class="otp_check_mobile help-block">
<ul class="list-unstyled">
<li>Please enter a valid OTP Recieved on your mobile number given in step 1!</li>
</ul>
</div>
<div style="margin-left:-11px;display:none;color:#a94442;" class="otp_enter_mobile help-block">
<ul class="list-unstyled">
<li>Please enter a OTP Recieved on your mobile number given in step 1!</li>
</ul>
</div>
<div style="margin-left:-11px;display:none;color:#a94442;" class="otp_status_mobile help-block">
<ul class="list-unstyled">
<li>Please enter a Valid OTP Recieved on your mobile number given in step 1!</li>
</ul>
</div>
<div class="help-block with-errors" style="margin-left:-148px;"></div>
<font color="red"><span id="signup_otp_error1"></span></font>
<span style="display:none;float:left; height: 25px;color: #337ab7;margin-top:5px;" class="signup_otp_sent_msg">OTP has been sent to Mobile & Email</span>
<a style="display:none;float:right; height: 25px;margin-top:5px;margin-bottom:18px;background-color: #337ab7;border-color: #2e6da4;color: #fff;" class="btn btn-primary btn-xs signup-resend-otp-link" href="javascript:void(0);">Resend OTP</a>
<!-- </div> -->
</div>
<div class="form-group">
<!-- <span id="dummy_otp_email"></span> -->
<label for="name" style="margin: 17px 0px 13px -269px;" id="style_email_otp" class="control-label">Email OTP (Same as Mobile OTP) </label>
<!-- <div class="input-group"> -->
<!-- <div class="input-group-addon"><i class="fa fa-at"></i></div> -->
<input type="text" onkeyup="clearerror(this.value);" pattern="\d*" autocomplete="off" placeholder="Enter an Email OTP" class="form-control" name="email_otp" id="email_otp" maxlength="6"
data-content="Please enter a valid OTP Recieved on your Email given in step 1." data-placement="top" data-trigger="hover" data-toggle="popover" required="" data-error="Please Enter Valid Email OTP!" data-original-title="" title="">
<a href="#" style="position: absolute; margin: -28px 0 0 180px;"><span class="glyphicon glyphicon-info-sign" data-toggle="tooltip" data-original-title="Please Enter OTP you recieved on email you have entered in step 1"></span></a>
<div class="help-block with-errors" style="margin-left:-148px;"></div>
<div style="margin-left:-11px;display:none;color:#a94442;" class="otp_check_email help-block">
<ul class="list-unstyled">
<li>Please enter a valid Email OTP Recieved on your Email given in step 1!</li>
</ul>
</div>
<div style="margin-left:-11px;display:none;color:#a94442;" class="otp_enter_email help-block">
<ul class="list-unstyled">
<li>Please enter a Email OTP Recieved on your mobile number given in step 1!</li>
</ul>
</div>
<div style="margin-left:-11px;display:none;color:#a94442;" class="otp_status_email help-block">
<ul class="list-unstyled">
<li>Please enter a Valid Email OTP Recieved on your mobile number given in step 1!</li>
</ul>
</div>
<!-- </div> -->
</div>
<div class="form-group">
<label for="name" style="margin: 0px 0px 13px -171px;" class="control-label">Organisation PAN Name</label>
<input type="text" pattern="[a-zA-Z0-9:.)(&\}\+\/\s\,\!\'-_]+" disabled="disabled" autocomplete="off" placeholder="Enter NGO Name As Appears On Pan Card" id="ngoo_pan_name" name="ngoo_pan_name" class="form-control" required=""
data-error="Please Enter Valid Pan Name!">
<div class="help-block with-errors"></div>
<div class="help-block with-errors pan_name_error" style="display:none;color:#a94442;"></div>
</div>
<div class="form-group">
<input type="checkbox" data-error="Please check if pan name is different from member name" name="ngo_name_differ" id="ngo_name_differ"> Please check if NGO name appears on pan card is different from NGO name you have entered <div
class="help-block with-errors"></div>
<div class="help-block with-errors pan_name_differ_error" style="display:none;color:#a94442;"></div>
</div>
<div class="form-group">
<label for="name" style="margin: 0px 0px 13px -160px;" class="control-label">Organisation PAN Number</label>
<input type="text" autocomplete="off" placeholder="Enter an Org Pan Number" class="form-control" name="org_pan" maxlength="10" id="org_pan" data-content="Please enter a valid Organisation PAN." data-placement="top" data-trigger="hover"
data-toggle="popover" required="" pattern="[a-zA-Z]{5}\d{4}[A-Za-z]{1}" data-error="Please Enter Valid PAN!" data-original-title="" title="">
<a href="#" style="position: absolute; margin: -28px 0 0 180px;"><span class="glyphicon glyphicon-info-sign" data-toggle="tooltip" data-original-title="Help text"></span></a>
<div class="help-block with-errors" style="margin-left:-148px;"></div>
<div style="margin-left:-11px;display:none;color:#a94442;" class="org_pan_enter help-block">
<ul class="list-unstyled">
<li>Please enter a Org PAN !</li>
</ul>
</div>
<div style="margin-left:-11px;display:none;color:#a94442;" class="org_pan_valid help-block">
<ul class="list-unstyled">
<li>Please enter a valid Org PAN Format!</li>
</ul>
</div>
<div style="margin-left:-11px;display:none;color:#a94442;" class="org_pan_status help-block">
<ul class="list-unstyled">
<li>Pan Already exist in our Records!</li>
</ul>
</div>
<div class="ngoo_pan_status" style="display:none;color:#fff;background-color: #5bbd72;"></div>
</div>
<div class="form-group">
<label for="org_pan_terms_check" class="control-label"></label>
<input type="checkbox" data-error="You must agree to the terms and conditions" name="org_pan_terms_check" id="org_pan_terms_check" style="margin: 0px 8px 0px -9px;">I agree to the
<a data-toggle="modal" href="javascript:void(0)" data-target="#popup5">NGO Pan Card terms and conditions</a>
<div class="help-block with-errors"></div>
<div class="help-block with-errors org_pan_terms_check_error" style="display:none;color:#a94442;"></div>
</div>
<div class="form-group">
<div id="captchaimagehere1" style="float: left; margin-bottom: 19px;margin-top: 6px;"><img src="https://ngodarpan.gov.in/captcha/1733904058.6039.jpg" style="width: 220; height: 40; border: 0;" alt=" "></div>
<div class="col-md-4"><a href="javascript:void(0)" class="refresh1" style="margin-right:50px;margin-bottom: 24px;"><img width="40px" height="40px" id="ref_symbol" src="https://ngodarpan.gov.in/assets/images/reload.png"></a></div>
</div>
<div class="form-group">
<input type="text" required="" autocomplete="off" class="form-control" placeholder="Enter Security Code Display Above" data-error="Please Enter Valid Security Code!" pattern="^[A-z0-9]{1,}$" id="captcha1" maxlength="8" value="">
<div class="help-block with-errors" style="margin-left:-140px;"></div>
<div style="margin-left:-3px;display:none;color:#a94442;" class="captcha_error1 help-block">
<ul class="list-unstyled">
<li>Please Enter Valid Security Code OR Close Window and Try Again!</li>
</ul>
</div>
</div>
<input type="hidden" value="" id="signup_otp_id" name="signup_otp_id">
<input type="hidden" value="" id="signup_otp_type" name="signup_otp_type">
<button type="submit" id="register_btn3" class="btn btn-block bt-login has-spinner" data-loading-text="Registering...." style="pointer-events: all; cursor: pointer;">Create Password</button>
<div class="clearfix"></div>
</form><form role="form" id="passwordForm" style="display:none;" data-toggle="validator" class="shake" novalidate="true">
<input type="hidden" name="csrf_test_name" value="1103cb0f557410bc566e558991fdc124">
<input type="hidden" id="request_key_p" value="">
<legend>Step 3 of 3</legend>
<div class="form-group">
<label for="name" style="margin: 0px 0px 13px -205px;" class="control-label">Organisation PAN</label>
<div class="input-group">
<input type="text" class="form-control" id="pan_ngo" value="">
</div>
</div>
<div class="form-group">
<label for="pwd" class="control-labl" style="margin: 0px 0px 13px -269px;">Password</label>
<div class="input-group">
<div class="input-group-addon"><i class="fa fa-key fa-fw"></i></div>
<input type="password" id="password1" name="password1" class="form-control" placeholder="Enter password" data-minlength="6"
data-content="Password must contain 6 to 10 characters and it must contain one upper case letter and one number. May contain letters (a-z, A-Z) ,numbers (0-9) and special characters like at (@), dollor ($), percent (%) and ampersnd (&).It is case-sensitive.Spaces are not permitted."
data-placement="top" data-trigger="hover" data-toggle="popover" required="" data-error="Please Enter Valid Password!" pattern="(?=.*\d)(?=.*[a-z])(?=.*[A-Z]).{6,}" data-original-title="" title="">
</div>
<div style="margin-left:-11px;display:none;color:#a94442;" class="password1_valid help-block">
<ul class="list-unstyled">
<li>Please enter Password</li>
</ul>
</div>
<div style="margin-left:-11px;display:none;color:#a94442;" class="password1_format help-block">
<ul class="list-unstyled">
<li>Password must contain 6 to 10 characters and it must contain one upper case letter and one number. May contain letters (a-z, A-Z) ,numbers (0-9) and special characters like at (@), dollor ($), percent (%) and ampersnd (&).It is
case-sensitive.Spaces are not permitted.</li>
</ul>
</div>
<div class="help-block with-errors" style="margin-left:-195px;"></div>
</div>
<div class="form-group">
<label for="confirm_pwd" class="control-label" style="margin: 0px 0px 13px -213px;">Confirm Password</label>
<div class="input-group">
<div class="input-group-addon"><i class="fa fa-key fa-fw"></i></div>
<input type="password" id="password2" name="password2" class="form-control" placeholder="Enter Confirm Password" data-content="Repeat Same Password" data-placement="top" data-trigger="hover" data-toggle="popover" required=""
data-error="Please Enter Confirm Password!" data-match="#password1" data-match-error="Password are not same" data-original-title="" title="">
</div>
<div style="margin-left:-11px;display:none;color:#a94442;" class="password2_valid help-block">
<ul class="list-unstyled">
<li>Please enter Confirm Password</li>
</ul>
</div>
<div style="margin-left:-11px;display:none;color:#a94442;" class="pwd_not_match help-block">
<ul class="list-unstyled">
<li>Password & Confirm Password must be same</li>
</ul>
</div>
<div class="help-block with-errors" style="margin-left:-139px;"></div>
</div>
<div class="form-group">
<div id="captchaimagehere2" style="float: left; margin-bottom: 15px;"><img src="https://ngodarpan.gov.in/captcha/1733904058.8191.jpg" style="width: 220; height: 40; border: 0;" alt=" "></div>
<div class="col-md-4"><a href="javascript:void(0)" class="refresh2" style="margin-right:50px;"><img width="40px" height="40px" id="ref_symbol" src="https://ngodarpan.gov.in/assets/images/reload.png"></a></div>
</div>
<div class="form-group">
<input type="text" pattern="^[A-z0-9]{1,}$" autocomplete="off" class="form-control" placeholder="Enter Security Code Display Above" required="" data-error="Please Enter Valid Security Code!" maxlength="8" id="captcha2" value="">
<div class="help-block with-errors" style="margin-left:-172px;"></div>
<div style="margin-left:-52px;display:none;color:#a94442;" class="captcha_error2 help-block">
<ul class="list-unstyled">
<li>Security code was not match, please try again!</li>
</ul>
</div>
</div>
<div>
<ul style="font-size:11px; font-weight:600; text-align : left; list-style-type:none ">
<li> - Step 2: PAN of NGO / Entity need to be given which will be matched with Name of NGO / Entity gien at Step 1 </li>
<li> - Step 3: Password can only be created when Step 2 is passed successfully </li>
</ul>
</div>
<input type="hidden" name="ngooo_pan_status" id="ngooo_pan_status" value="">
<input type="hidden" name="sdfdfdfsdfsdfdsf" id="sdfdfdfsdfsdfdsf" value="">
<input type="hidden" name="ngooo_pan_datetime" id="ngooo_pan_datetime" value="">
<input type="hidden" name="ngooo_pan_combined" id="ngooo_pan_combined" value="">
<button type="submit" id="register_btn2" class="btn btn-block bt-login has-spinner" data-loading-text="Registering...." style="pointer-events: all; cursor: pointer;">Submit Registration</button>
<div class="clearfix"></div>
</form><form role="form" id="forgetForm" data-toggle="validator" class="shake" novalidate="true">
<input type="hidden" name="csrf_test_name" value="1103cb0f557410bc566e558991fdc124">
<font color="red"><span id="attempt_limit"></span></font>
<div class="form-group">
<div class="input-group">
<div class="input-group-addon"><i class="fa fa-user"></i></div>
<input type="text" autocomplete="off" onkeyup="chekmailphon(this.value);" class="form-control" id="femail" placeholder="Email OR Mobile Number" required="" data-error="Please Enter Email OR Mobile Number!">
</div>
<div class="help-block with-errors" style="margin-left:-105px;"></div>
<span class="help-block has-error" data-error="0" id="femail-error"></span>
<div style="margin-left:-52px;display:none;color:#a94442;" class="invalid_email_phone help-block">
<ul class="list-unstyled">
<li>Invalid email or phone format!</li>
</ul>
</div>
<div style="margin-left:-52px;display:none;color:#a94442;" class="account_not_exist help-block">
<ul class="list-unstyled">
<li>Login ID does not exist in our Records!</li>
</ul>
</div>
<div style="margin-left:-52px;display:none;color:#a94442;" class="invalid_request help-block">
<ul class="list-unstyled">
<li>Login ID does not exist in our Records!</li>
</ul>
</div>
</div>
<div class="form-group">
<div id="captchaimagehere12" style="float: left; margin-bottom: 15px;"><img src="https://ngodarpan.gov.in/captcha/1733904059.0368.jpg" style="width: 220; height: 40; border: 0;" alt=" "></div>
<div class="col-md-4"><a href="javascript:void(0)" class="refresh12" style="margin-right:50px;"><img width="40px" height="40px" id="ref_symbol" src="https://ngodarpan.gov.in/assets/images/reload.png"></a></div>
</div>
<div class="form-group">
<input type="text" autocomplete="off" class="form-control" placeholder="Enter Security Code Display Above" required="" data-error="Please Enter Valid Security Code!" pattern="^[A-z0-9]{1,}$" id="captcha12" maxlength="8" value="">
<div class="help-block with-errors" style="margin-left:-172px;"></div>
<div style="margin-left:-52px;display:none;color:#a94442;" class="captcha_error12 help-block">
<ul class="list-unstyled">
<li>Please Enter Valid Security Code OR Close Window and Try Again!</li>
</ul>
</div>
</div>
<button type="submit" id="forgetForm_btn" class="btn btn-block bt-login has-spinner" data-loading-text="Please wait...." style="pointer-events: all; cursor: pointer;">Get Password</button>
<div class="clearfix"></div>
</form><form role="form" id="forgetForm2old" data-toggle="validator" class="shake" style="display:none;" novalidate="true">
<input type="hidden" name="csrf_test_name" value="1103cb0f557410bc566e558991fdc124">
<div class="form-group">
<div class="form-group" id="form_forget_ngo_name">
<label for="name" style="margin: 0px 0px 13px -258px;" class="control-label">NGO Name</label>
<input type="text" class="form-control" id="old_ngo_name" value="" readonly="">
</div>
<div class="form-group" id="form_forget_ngo_email">
<label for="name" style="margin: 0px 0px 13px -205px;" class="control-label">Registered Email</label>
<input type="text" class="form-control" id="old_ngo_email" value="" readonly="">
</div>
<div class="form-group" id="form_forget_ngo_mobile">
<label for="name" style="margin: 0px 0px 13px -205px;" class="control-label">Registered Mobile</label>
<input type="text" class="form-control" id="old_ngo_mobile" value="" readonly="">
</div>
<div class="form-group">
<!-- <label for="name" style="margin: 0px 0px 13px -172px;" class="control-label">Enter OTP (OTP:<span id="for_otp"></span>)</label> -->
<label for="name" style="margin: 0px 0px 13px -272px;" class="control-label">Enter OTP</label>
<input type="text" onkeyup="clearerror(this.value);" autocomplete="off" class="form-control" id="otp" placeholder="Please Enter OTP" pattern="\d{6}" maxlength="6" required="" data-error="Please Enter OTP!">
<font color="red"><span id="otp_error"></span></font>
<span style="display:block;float:left; height: 25px;color: #337ab7;margin-top:20px;" class="otp_sent_msg">OTP has been sent!</span>
<a style="display:none;float:right; height: 25px;margin-top:13px;margin-bottom:18px;background-color: #337ab7;border-color: #2e6da4;color: #fff;" class="btn btn-primary btn-xs resend-otp-link" href="javascript:void(0);">Resend OTP</a>
</div>
<div class="help-block with-errors" style="margin-left:-260px;"></div>
<div style="margin-left:-52px;display:none;color:#a94442;" class="invalid_email_phone_otp help-block">
<ul class="list-unstyled">
<li>Please enter Valid OTP!</li>
</ul>
</div>
<div class="form-group">
<label for="pwd" class="control-labl" style="margin:8px 192px 10px -35px;">Enter Password</label>
<div class="input-group">
<div class="input-group-addon"><i class="fa fa-key fa-fw"></i></div>
<input type="password" id="otp_password1" name="otp_password1" class="form-control" placeholder="Enter password" data-minlength="6"
data-content="Password must contain 6 to 10 characters and it must contain one upper case letter and one number. May contain letters (a-z, A-Z) ,numbers (0-9) and special characters like at (@), dollor ($), percent (%) and ampersnd (&).It is case-sensitive.Spaces are not permitted."
data-placement="top" data-trigger="hover" data-toggle="popover" required="" data-error="Please Enter Password!" pattern="(?=.*\d)(?=.*[a-z])(?=.*[A-Z]).{6,}" data-original-title="" title="">
</div>
<div style="margin-left:-11px;display:none;color:#a94442;" class="password11_valid help-block">
<ul class="list-unstyled">
<li>Please enter Password</li>
</ul>
</div>
<div style="margin-left:-11px;display:none;color:#a94442;" class="password11_format help-block">
<ul class="list-unstyled">
<li>Password must contain 6 to 10 characters and it must contain one upper case letter and one number. May contain letters (a-z, A-Z) ,numbers (0-9) and special characters like at (@), dollor ($), percent (%) and ampersnd (&).It is
case-sensitive.Spaces are not permitted.</li>
</ul>
</div>
<div class="help-block with-errors" style="margin-left:-195px;"></div>
</div>
<div class="form-group">
<label for="confirm_pwd" class="control-label" style="margin: 0px 0px 13px -167px;">Enter Confirm Password</label>
<div class="input-group">
<div class="input-group-addon"><i class="fa fa-key fa-fw"></i></div>
<input type="password" id="otp_password2" name="otp_password2" class="form-control" placeholder="Enter Confirm Password" data-content="Repeat Same Password" data-placement="top" data-trigger="hover" data-toggle="popover" required=""
data-error="Please Enter Confirm Password!" data-match="#otp_password1" data-match-error="Password are not same" data-original-title="" title="">
</div>
<div style="margin-left:-11px;display:none;color:#a94442;" class="password22_valid help-block">
<ul class="list-unstyled">
<li>Please enter Confirm Password</li>
</ul>
</div>
<div style="margin-left:-11px;display:none;color:#a94442;" class="pwd1_not_match help-block">
<ul class="list-unstyled">
<li>Password & Confirm Password must be same</li>
</ul>
</div>
<div class="help-block with-errors" style="margin-left:-139px;"></div>
</div>
</div>
<input type="hidden" value="" id="for_otp_id" name="for_otp_id">
<input type="hidden" value="F" id="for_otp_type" name="for_otp_type">
<input type="hidden" value="" id="for_resend_otp_id" name="for_resend_otp_id">
<input type="hidden" value="" id="resend_mobile_otp" name="resend_mobile_otp">
<input type="hidden" value="" id="resend_email_otp" name="resend_email_otp">
<button type="submit" id="forgetForm2old_btn" class="btn btn-block bt-login has-spinner" data-loading-text="Please wait...." style="pointer-events: all; cursor: pointer;">Generate Password</button>
<div class="clearfix"></div>
</form><form role="form" id="login_otp_form" style="display:none;" novalidate="true">
<input type="hidden" name="csrf_test_name" value="1103cb0f557410bc566e558991fdc124">
<legend>Sign In with OTP</legend>
<div class="form-group">
<div class="form-group">
<label for="name" style="margin: 0px 0px 13px -55px;" class="control-label">Enter your Registered Mobile</label>
<input type="text" autocomplete="off" class="form-control" id="reg_alt_mobile" placeholder="Enter Registered Mobile" maxlength="10"
data-content="Please enter a valid 10-digit mobile number without any country code. You will receive an OTP at given mobile number." data-placement="top" data-trigger="hover" data-toggle="popover" pattern="[789][0-9]{9}"
data-error="Please Enter Valid Mobile Number!" required="" data-original-title="" title="">
</div>
<div class="help-block with-errors" style="margin-left:-195px;"></div>
</div>
<div class="invalid_mobile_error alert alert-danger" role="alert" style="display:none;"> Your Mobile Number is not Valid </div>
<div class="reg_alt_account_not_exist alert alert-danger" role="alert" style="display:none;"> Your Mobile Number does not Exist in Records </div>
<button type="submit" id="login_otp_form_btn" class="btn btn-block bt-login has-spinner" data-loading-text="Please wait...." style="pointer-events: all; cursor: pointer;">Generate OTP</button>
<div class="clearfix"></div>
</form><form role="form" id="login_otp_form2" data-toggle="validator" style="display:none;" novalidate="true">
<input type="hidden" name="csrf_test_name" value="1103cb0f557410bc566e558991fdc124">
<legend>Enter OTP Recieved On your Mobile</legend>
<div class="form-group">
<div class="form-group">
<label for="name" style="margin: 0px 0px 13px -55px;" class="control-label">Enter OTP</label>
<input type="text" pattern="\d{6}" class="form-control" id="alt_mob_otp" placeholder="Enter OTP" name="alt_mob_otp" maxlength="6" data-content="Please enter a valid OTP Recieved on your mobile number" autocomplete="off" data-placement="top"
data-trigger="hover" data-toggle="popover" required="" data-error="Please Enter Mobile OTP!" data-original-title="" title="">
<span style="display:block;float:left; height: 25px;color: #337ab7;margin:20px 0px 20px;" class="login_otp_sent_msg">OTP has been sent to Mobile</span>
<a style="display:none;float:right; height: 25px;margin-top:13px;margin-bottom:18px;background-color: #337ab7;border-color: #2e6da4;color: #fff;" class="btn btn-primary btn-xs resend-login-otp-link" href="javascript:void(0);">Resend OTP</a>
</div>
<div class="help-block with-errors" style="margin-left:-195px;"></div>
</div>
<div class="otp_not_exist alert alert-danger" role="alert" style="display:none;margin: 45px 0px 14px -5px;"> Please Enter Valid OTP Sent To Your Mobile </div>
<input type="hidden" value="" id="login_otp_id" name="login_otp_id">
<input type="hidden" value="L" id="login_otp_type" name="login_otp_id">
<input type="hidden" value="" id="alt_hidden_mobile" name="alt_hidden_mobile">
<button type="submit" id="login_otp_form2_btn" class="btn btn-block bt-login has-spinner" data-loading-text="Please wait...." style="pointer-events: all; cursor: pointer;">Login</button>
<div class="clearfix"></div>
</form>POST
<form id="search-form" method="post">
<input type="hidden" name="csrf_test_name" value="1103cb0f557410bc566e558991fdc124">
<input name="mod" value="search" type="hidden">
<input name="search_type" value="search_form" type="hidden">
<input name="lang" value="en" type="hidden">
<div class="search_error" style="display:none;margin-left:15px;color: #fff;background: #dc005a none repeat scroll 0 0;">
<ul class="list-unstyled">
<li>Please Choose any element to search NGO'S!</li>
</ul>
</div>
<div id="search_form_container">
<div class="form-group">
<label class="control-label col-md-2" for="state_search_search">
<small>State</small>
</label>
<div class="control-field no-right-padding col-md-10">
<!-- <select name="state_search_search" id="state_search_search" class="form-control input-sm" onchange="get_district(this.value)" multiple> -->
<select name="state_search_search" id="state_search_search" class="form-control input-sm select2-hidden-accessible" onchange="get_district(this.value)" tabindex="-1" aria-hidden="true">
<option value="">Select</option>
<option value="35">ANDAMAN & NICOBAR ISLANDS</option>
<option value="28">ANDHRA PRADESH</option>
<option value="12">ARUNACHAL PRADESH</option>
<option value="18">ASSAM</option>
<option value="10">BIHAR</option>
<option value="4">CHANDIGARH</option>
<option value="22">CHHATTISGARH</option>
<option value="26">DADRA & NAGAR HAVELI</option>
<option value="25">DAMAN & DIU</option>
<option value="7">DELHI</option>
<option value="30">GOA</option>
<option value="24">GUJARAT</option>
<option value="6">HARYANA</option>
<option value="2">HIMACHAL PRADESH</option>
<option value="1">JAMMU & KASHMIR</option>
<option value="20">JHARKHAND</option>
<option value="29">KARNATAKA</option>
<option value="32">KERALA</option>
<option value="37">LADAKH</option>
<option value="31">LAKSHADWEEP</option>
<option value="23">MADHYA PRADESH</option>
<option value="27">MAHARASHTRA</option>
<option value="14">MANIPUR</option>
<option value="17">MEGHALAYA</option>
<option value="15">MIZORAM</option>
<option value="13">NAGALAND</option>
<option value="21">ORISSA</option>
<option value="34">PUDUCHERRY</option>
<option value="3">PUNJAB</option>
<option value="8">RAJASTHAN</option>
<option value="11">SIKKIM</option>
<option value="33">TAMIL NADU</option>
<option value="36">TELANGANA</option>
<option value="16">TRIPURA</option>
<option value="9">UTTAR PRADESH</option>
<option value="5">UTTARAKHAND</option>
<option value="19">WEST BENGAL</option>
</select><span class="select2 select2-container select2-container--default" dir="ltr" style="width: 100%;"><span class="selection"><span class="select2-selection select2-selection--single" role="combobox" aria-haspopup="true"
aria-expanded="false" tabindex="0" aria-labelledby="select2-state_search_search-container"><span class="select2-selection__rendered" id="select2-state_search_search-container"><span class="select2-selection__placeholder">Select
State</span></span><span class="select2-selection__arrow" role="presentation"><b role="presentation"></b></span></span></span><span class="dropdown-wrapper" aria-hidden="true"></span></span>
</div>
</div>
<br><br><br>
<div class="form-group">
<label class="control-label col-md-2" for="district_search">
<small>District</small>
</label>
<div class="control-field no-right-padding col-md-10">
<select class="form-control input-sm select2-hidden-accessible" id="district_search" name="district_search" tabindex="-1" aria-hidden="true">
<option value="">Select District</option>
</select><span class="select2 select2-container select2-container--default" dir="ltr" style="width: 100%;"><span class="selection"><span class="select2-selection select2-selection--single" role="combobox" aria-haspopup="true"
aria-expanded="false" tabindex="0" aria-labelledby="select2-district_search-container"><span class="select2-selection__rendered" id="select2-district_search-container"><span class="select2-selection__placeholder">Select
District</span></span><span class="select2-selection__arrow" role="presentation"><b role="presentation"></b></span></span></span><span class="dropdown-wrapper" aria-hidden="true"></span></span>
</div>
</div>
<br><br>
<div class="form-group">
<label class="control-label col-md-2" for="sector_search">
<small>Sector</small>
</label>
<div class="control-field no-right-padding col-md-10">
<select class="form-control input-sm select2-hidden-accessible" id="sector_search" name="sector_search" multiple="" tabindex="-1" aria-hidden="true">
<option value="">Select</option>
<option value="1"> Agriculture </option>
<option value="2"> Animal Husbandry, Dairying & Fisheries </option>
<option value="3"> Art & Culture </option>
<option value="4"> Biotechnology </option>
<option value="5"> Children </option>
<option value="6"> Civic Issues </option>
<option value="7"> Dalit Upliftment </option>
<option value="8"> Differently Abled </option>
<option value="9"> Disaster Management </option>
<option value="10"> Drinking Water </option>
<option value="11"> Education & Literacy </option>
<option value="12"> Aged/Elderly </option>
<option value="13"> Environment & Forests </option>
<option value="14"> Food Processing </option>
<option value="15"> Health & Family Welfare </option>
<option value="16"> HIV/AIDS </option>
<option value="17"> Housing </option>
<option value="18"> Human Rights </option>
<option value="19"> Information & Communication Technology </option>
<option value="20"> Labour & Employment </option>
<option value="21"> Land Resources </option>
<option value="22"> Legal Awareness & Aid </option>
<option value="23"> Micro Finance (SHGs) </option>
<option value="24"> Micro Small & Medium Enterprises </option>
<option value="25"> Minority Issues </option>
<option value="26"> New & Renewable Energy </option>
<option value="27"> Nutrition </option>
<option value="28"> Panchayati Raj </option>
<option value="29"> Prisoner's Issues </option>
<option value="30"> Right to Information & Advocacy </option>
<option value="31"> Rural Development & Poverty Alleviation </option>
<option value="32"> Science & Technology </option>
<option value="33"> Scientific & Industrial Research </option>
<option value="34"> Sports </option>
<option value="35"> Tourism </option>
<option value="36"> Tribal Affairs </option>
<option value="37"> Urban Development & Poverty Alleviation </option>
<option value="38"> Vocational Training </option>
<option value="39"> Water Resources </option>
<option value="40"> Women's Development & Empowerment </option>
<option value="41"> Youth Affairs </option>
<option value="42"> Any Other </option>
<option value="43"> Skill Development </option>
<option value="44"> Animal Welfare </option>
</select><span class="select2 select2-container select2-container--default" dir="ltr" style="width: 100%;"><span class="selection"><span class="select2-selection select2-selection--multiple" role="combobox" aria-haspopup="true"
aria-expanded="false" tabindex="-1">
<ul class="select2-selection__rendered">
<li class="select2-search select2-search--inline"><input class="select2-search__field" type="search" tabindex="0" autocomplete="off" autocorrect="off" autocapitalize="off" spellcheck="false" role="textbox" aria-autocomplete="list"
placeholder="Select Sectors" style="width: 312px;"></li>
</ul>
</span></span><span class="dropdown-wrapper" aria-hidden="true"></span></span>
</div>
</div>
<br><br>
<div class="form-group">
<label class="control-label col-md-2" for="ngo_type_search">
<small>NGO Type</small>
</label>
<div class="control-field no-right-padding col-md-10">
<select class="form-control input-sm select2-hidden-accessible" id="ngo_type_search" name="ngo_type_search" multiple="" tabindex="-1" aria-hidden="true">
<option value="">Select</option>
<option value="1"> Private Sector Companies (Sec 8/25) </option>
<option value="3"> Registered Societies (Non-Government) </option>
<option value="4"> Trust (Non-Government) </option>
<option value="5"> Other Registered Entities (Non-Government) </option>
<option value="6"> Academic Institutions (Private) </option>
<option value="7"> Academic Institutions (Govt) </option>
</select><span class="select2 select2-container select2-container--default" dir="ltr" style="width: 100%;"><span class="selection"><span class="select2-selection select2-selection--multiple" role="combobox" aria-haspopup="true"
aria-expanded="false" tabindex="-1">
<ul class="select2-selection__rendered">
<li class="select2-search select2-search--inline"><input class="select2-search__field" type="search" tabindex="0" autocomplete="off" autocorrect="off" autocapitalize="off" spellcheck="false" role="textbox" aria-autocomplete="list"
placeholder="Select Ngo Type" style="width: 312px;"></li>
</ul>
</span></span><span class="dropdown-wrapper" aria-hidden="true"></span></span>
</div>
</div>
<br><br>
<div class="form-group">
<label class="control-label col-md-2" for="ngo_name_search">
<small>NGO Name</small>
</label>
<div class="control-field no-right-padding col-md-10">
<input class="form-control input-sm" id="ngo_name_search" placeholder="Search By Enter Ngo Name" name="ngo_name_search" autocomplete="off" maxlength="50" type="text">
</div>
</div>
<br><br>
<div class="form-group">
<label class="control-label col-md-3" for="unique_id_search">
<small>Unique ID</small>
</label>
<div class="control-field no-right-padding col-md-9">
<input class="form-control input-sm" id="unique_id_search" placeholder="Search By Enter Unique ID" name="unique_id_search" autocomplete="off" maxlength="20" value="" type="text">
</div>
</div>
<br>
<!-- <div class="form-group btn-group" data-toggle="buttons" style="margin: 0px 38px;">
<label class="btn btn-default active">
<input type="radio" name="view_type" id="view_type" value="detail_view" /> Detail View
</label>
<label class="btn btn-default">
<input type="radio" name="view_type" id="view_type" value="summary_view" />Summary View
</label>
</div> -->
<div class="form-group">
<label class="control-label col-md-3"></label>
<div class="control-field no-right-padding col-sm-5" style="margin-top: 15px;">
<input class="btn btn-primary pull-left" name="commit" value="Search" type="submit">
</div>
<div class="control-field no-right-padding col-sm-4" style="margin-top: 15px;">
<input class="btn btn-danger" value="Reset" type="reset" id="reset">
</div>
</div>
</div>
</form>POST
<form method="post" id="some_form">
<input type="hidden" id="csrff" name="csrf_test_name" value="1103cb0f557410bc566e558991fdc124">
</form>Text Content
Search
* Screen Reader Access
* Skip to main content
* +A A -A
* A A
* Login/Register
Toggle navigation
* NITI Aayog, Government of India
* Home
*
* NGO Directory
* Search NGOs
*
*
* Circulars
* Help
* Signup Process
* How to Signup (Hindi)
* How to Signup (English)
* FAQs
* Grant-in-aid Portals
* Blacklisted NGOs
* Login/Register
Helpdesk Contact Numbers: Please call at 14414 or
011-23042707/23042322/23042646/23042145/23042322 between 9:30 AM to 5:30 PM on
working days or email to ngo@india.gov.in for registration assistance. Please
refer to Contact Us link at the bottom of page for more options to contact
Darpan Team.
×
USER AUTHENTICATION
* Sign In
* Sign Up
* Forgot Password
* - Click on 'Signin' if you already have the account
* - Click on 'SignUp' for creating a new account
* - Click on 'Forgot Pasword' if not getting correct password
* - you can also Login using OTP
* - SignIn will not work, If Account is in Archive mode, Contact Darpan Support
Team
Loggin failed, please try again.
* UserID or password is Invalid.
* Please Enter Valid Login ID, valid characters are a-z, A-Z, 0-9, the
underscore (_), and the dash (-). Spaces are not permitted.
* Please enter valid Password!
* Please Enter Valid Security Code OR Close Window and Try Again!
UserID or password is Invalid
Forget Password Login Via OTP Sign In
Registration failed, please try again.
Step 1 of 3
Name of NGO/VO
* Ngo Name Already exist in Records!
* Please Enter Ngo Name!
* Please Enter valid Ngo Name with valid alphabets Characters
* Please Enter valid Ngo Name length
Contact Person Mobile Number
* Mobile Already exist in Records!
* Please enter Mobile Number!
* Enter valid Mobile Number that contains valid 10 Numeric Character without
"0" & "91"!
Contact Person Email
* Email Already exist in Records!
* Please Enter Email!
* Please Enter Valid Email!
* Please Enter Valid Security Code OR Close Window and Try Again!
* - There are total 3 Steps for Creating an Account at Portal
* - Step 1 : Input NGO / Entity Name exactly similar as given in PAN Card
* - Email and Mobile number should be working and accessible for OTPs.
* - Step 2: PAN of NGO / Entity need to be given which will be matched with
Name of NGO / Entity given at Step 1
* - Step 3: Password can only be created when Step 2 is passed successfully
Submit
Step 2 of 3
Name of NGO/VO
Contact Person Mobile Number
Contact Person Email
Mobile OTP
* Please enter a valid OTP Recieved on your mobile number given in step 1!
* Please enter a OTP Recieved on your mobile number given in step 1!
* Please enter a Valid OTP Recieved on your mobile number given in step 1!
OTP has been sent to Mobile & Email Resend OTP
Email OTP (Same as Mobile OTP)
* Please enter a valid Email OTP Recieved on your Email given in step 1!
* Please enter a Email OTP Recieved on your mobile number given in step 1!
* Please enter a Valid Email OTP Recieved on your mobile number given in step
1!
Organisation PAN Name
Please check if NGO name appears on pan card is different from NGO name you have
entered
Organisation PAN Number
* Please enter a Org PAN !
* Please enter a valid Org PAN Format!
* Pan Already exist in our Records!
I agree to the NGO Pan Card terms and conditions
* Please Enter Valid Security Code OR Close Window and Try Again!
Create Password
Step 3 of 3
Organisation PAN
Password
* Please enter Password
* Password must contain 6 to 10 characters and it must contain one upper case
letter and one number. May contain letters (a-z, A-Z) ,numbers (0-9) and
special characters like at (@), dollor ($), percent (%) and ampersnd (&).It
is case-sensitive.Spaces are not permitted.
Confirm Password
* Please enter Confirm Password
* Password & Confirm Password must be same
* Security code was not match, please try again!
* - Step 2: PAN of NGO / Entity need to be given which will be matched with
Name of NGO / Entity gien at Step 1
* - Step 3: Password can only be created when Step 2 is passed successfully
Submit Registration
* Invalid email or phone format!
* Login ID does not exist in our Records!
* Login ID does not exist in our Records!
* Please Enter Valid Security Code OR Close Window and Try Again!
Get Password
NGO Name
Registered Email
Registered Mobile
Enter OTP OTP has been sent! Resend OTP
* Please enter Valid OTP!
Enter Password
* Please enter Password
* Password must contain 6 to 10 characters and it must contain one upper case
letter and one number. May contain letters (a-z, A-Z) ,numbers (0-9) and
special characters like at (@), dollor ($), percent (%) and ampersnd (&).It
is case-sensitive.Spaces are not permitted.
Enter Confirm Password
* Please enter Confirm Password
* Password & Confirm Password must be same
Generate Password
Sign In with OTP
Enter your Registered Mobile
Your Mobile Number is not Valid
Your Mobile Number does not Exist in Records
Generate OTP
Enter OTP Recieved On your Mobile
Enter OTP OTP has been sent to Mobile Resend OTP
Please Enter Valid OTP Sent To Your Mobile
Login
×
NGO PAN CARD TERMS AND CONDITIONS
I have agreed to taken consent for furnishing my NGO Pan number for NGO - PS
Portal.
INSTRUCTIONS
KEY INSTRUCTIONS FOR SIGN-IN
NGO Darpan Portal
***
HOW TO SIGN IN?
1. Click on 'Signin' if you already have the account
2. Click on 'SignUp' for creating a new account
3. Click on 'Forgot Pasword' if not getting correct password
4. you can also Login using OTP
5. SignIn will not work, If Account is in Archive mode, Contact Darpan Support
Team
We have read, understood and agreed to the above instructions /checklist.
Proceed to Sign up
INSTRUCTIONS
KEY INSTRUCTIONS FOR NEW SIGN-UPS
NGO Darpan Portal
***
* Please read the instructions carefully before completing the NGO Darpan
Unique ID application form.
* Please keep the following documents in PDF format (less than 2 MB) with color
scan of the original documents for uploading.
* Original Registration certificate and complete Memorandum of Association
(MOA) or Trust Deed. Clearly showing the stamp/e-sign of the Office of
Registrar of Societies / Trust/Section 8 companies act/any other
registering authority.
* Scanned copy of By Laws of the Organization (if not mentioned in MoA).
* Objectives of the organization (if not mentioned in MoA).
* Certified list of present Governing Body Members (if not mentioned in
MoA).
* The latest Resolution copy if any.
* If any of the above documents are in vernacular languages other than Hindi or
English, the translated version of the documents in Hindi or English should
be duly attested by the head of the organization and scanned and merged with
the original documents to create a single PDF file.
* PAN Card number of the NGO (automatically verified online).
* PAN and Aadhar Card Numbers of Chairman/President/Secretary/
Treasurer/members or equivalent post in the organization, which will be
automatically verified online. The minimum number of office bearers required
for registration is mentioned below:-
* If the entity is Society:- Three members
* If the entity is Trust:- Two members
* If the entity is Section 8 company- One member
* NGO / Entity Name given during the registration process should exactly match
the one given on the PAN Card of the NGO.
* The email and mobile number used for the signing-up process should belong to
the organisation's Chairman/President/ Secretary/Treasurer or equivalent
designation. Using any other person's key contact details will lead to
cancellation of the registration without any intimation.
* Please carefully fill out all details of the registration process fields. If
any false/misleading information is found, the NGO Darpan Unique ID of the
organization will be suspended/cancelled immediately without any intimation.
* After submitting the online form, if any modification is requested by NGO
Darpan Portal helpdesk, the same must be complied with immediately and
positively within 30 days from the date of the modification request. Failing,
the application will be rejected. Please keep on regularly checking on your
login page for modification requests.
HOW TO SIGN UP?
1. There are total 3 Steps for Creating an Account at Portal
2. Step 1: Input NGO / Entity Name exactly similar as given on PAN Card
3. Email and Mobile number should be working and accessible for OTPs
4. Step 2: PAN of NGO / Entity need to be given which will be matched with Name
of NGO / Entity gien at Step 1
5. Step 3: Password can only be created when Step 2 is passed successfully
We have read, understood and agreed to the above instructions /checklist.
Proceed to Sign up
INSTRUCTIONS
KEY INSTRUCTIONS FOR FORGET PASSWORD
NGO Darpan Portal
***
HOW TO GET FORGOT PASSWORD?
We have read, understood and agreed to the above instructions /checklist.
Proceed to Sign up
Search for a NGO
--------------------------------------------------------------------------------
--------------------------------------------------------------------------------
SEARCH FOR A NGO
* Please Choose any element to search NGO'S!
State
Select ANDAMAN & NICOBAR ISLANDS ANDHRA PRADESH ARUNACHAL PRADESH ASSAM BIHAR
CHANDIGARH CHHATTISGARH DADRA & NAGAR HAVELI DAMAN & DIU DELHI GOA GUJARAT
HARYANA HIMACHAL PRADESH JAMMU & KASHMIR JHARKHAND KARNATAKA KERALA LADAKH
LAKSHADWEEP MADHYA PRADESH MAHARASHTRA MANIPUR MEGHALAYA MIZORAM NAGALAND ORISSA
PUDUCHERRY PUNJAB RAJASTHAN SIKKIM TAMIL NADU TELANGANA TRIPURA UTTAR PRADESH
UTTARAKHAND WEST BENGAL Select State
District
Select DistrictSelect District
Sector
Select Agriculture Animal Husbandry, Dairying & Fisheries Art & Culture
Biotechnology Children Civic Issues Dalit Upliftment Differently Abled Disaster
Management Drinking Water Education & Literacy Aged/Elderly Environment &
Forests Food Processing Health & Family Welfare HIV/AIDS Housing Human Rights
Information & Communication Technology Labour & Employment Land Resources Legal
Awareness & Aid Micro Finance (SHGs) Micro Small & Medium Enterprises Minority
Issues New & Renewable Energy Nutrition Panchayati Raj Prisoner's Issues Right
to Information & Advocacy Rural Development & Poverty Alleviation Science &
Technology Scientific & Industrial Research Sports Tourism Tribal Affairs Urban
Development & Poverty Alleviation Vocational Training Water Resources Women's
Development & Empowerment Youth Affairs Any Other Skill Development Animal
Welfare
*
NGO Type
Select Private Sector Companies (Sec 8/25) Registered Societies (Non-Government)
Trust (Non-Government) Other Registered Entities (Non-Government) Academic
Institutions (Private) Academic Institutions (Govt)
*
NGO Name
Unique ID
WELCOME TO A NGO DIRECTORY TOTAL ACTIVE NGO'S: 272700
* NGO TYPE SUMMARY
* STATEWISE SUMMARY
Private Sector Companies (Sec8/25)Registered Societies (Non-Government)Trust
(Non-Government)Other Registered Entities (Non-Government)Academic Institutions
(Private)Other7.9%41.2%47.8%
NGO TYPENGO COUNTPrivate Sector Companies (Sec 8/25)18,913Registered Societies
(Non-Government)114,002Trust (Non-Government)98,148Other Registered Entities
(Non-Government)3,614Academic Institutions (Private)3,437Academic Institutions
(Govt)223
Academic Institutions (Private)
010,00020,00030,00040,000ANDAMAN & NICOBAR ISLANDSANDHRA PRADESHARUNACHAL
PRADESHASSAMBIHARCHANDIGARHCHHATTISGARHDADRA & NAGAR HAVELIDAMAN &
DIUDELHIGOAGUJARATHARYANAHIMACHAL PRADESHJAMMU &
KASHMIRJHARKHANDKARNATAKAKERALALADAKHLAKSHADWEEPMADHYA
PRADESHMAHARASHTRAMANIPURMEGHALAYAMIZORAMNAGALANDORISSAPUDUCHERRYPUNJABRAJASTHANSIKKIMTAMIL
NADUTELANGANATRIPURAUTTAR PRADESHUTTARAKHANDWEST
BENGAL1971979476947665465439643964871787174384383246324658583333188851888549049013861138617893789312991299235123514312431215842158427642764222022010101146811468354923549231803180446446346346629629649264924764764483448311864118641821821854018540847884786826823657736577354335431822018220NGO
COUNT
18220
DATA SEARCHED
Please Enter Search Criteria from Above Form
×
NGO DETAILS
Unique Id of VO/NGO DARPAN Reg. Date
REGISTRATION DETAILS
Registered With Sub-Registrar Type of NGO Trust Registration No Act name City of
Registration State of Registration Date of Registration (Society / Trust /
Entity)
OFFICE BEARERS
SECTORS
Operational Sectors Operational Area-States Operational Area-District
DETAILS OF ACHIEVEMENTS
SOURCE OF FUNDS
CONTACT DETAILS
Address City State Telephone Mobile No Website Url E-mail Last modified on
* Home
* Site Map
* Privacy Policy
* Link to us
* FAQs
* Linking Policy
* Terms of Use
* Contact Us
* Copyright Policy
2024 All rights reserved. Content of the portal owned & maintained by NITI
Aayog, Govt of India. Portal designed and hosted by National Informatics Centre,
Ministry of Electronics & Information Technology (MeitY), Government of India.
[Best view in Chrome 56.0 or higher,Firefox 52.0 or higher]