discordbotshop.maplevillekitchensremodeling.com
Open in
urlscan Pro
173.254.28.225
Public Scan
Submission Tags: phishingrod
Submission: On February 16 via api from DE — Scanned from DE
Summary
TLS certificate: Issued by R3 on December 17th 2023. Valid for: 3 months.
This is the only time discordbotshop.maplevillekitchensremodeling.com was scanned on urlscan.io!
urlscan.io Verdict: No classification
Domain & IP information
IP Address | AS Autonomous System | ||
---|---|---|---|
1 | 173.254.28.225 173.254.28.225 | 46606 (UNIFIEDLA...) (UNIFIEDLAYER-AS-1) | |
1 | 1 |
ASN46606 (UNIFIEDLAYER-AS-1, US)
PTR: just2021.justhost.com
discordbotshop.maplevillekitchensremodeling.com |
Apex Domain Subdomains |
Transfer | |
---|---|---|
1 |
maplevillekitchensremodeling.com
discordbotshop.maplevillekitchensremodeling.com |
404 B |
1 | 1 |
Domain | Requested by | |
---|---|---|
1 | discordbotshop.maplevillekitchensremodeling.com | |
1 | 1 |
This site contains no links.
Subject Issuer | Validity | Valid | |
---|---|---|---|
simplydryinc.maplevillekitchensremodeling.com R3 |
2023-12-17 - 2024-03-16 |
3 months | crt.sh |
This page contains 1 frames:
Primary Page:
https://discordbotshop.maplevillekitchensremodeling.com/
Frame ID: DEC2007CAE3E0B392BF9B9F580E37474
Requests: 1 HTTP requests in this frame
0 Outgoing links
These are links going to different origins than the main page.
Redirected requests
There were HTTP redirect chains for the following requests:
1 HTTP transactions
Method Protocol |
Resource Path |
Size x-fer |
Type MIME-Type |
||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
GET H2 |
Primary Request
/
discordbotshop.maplevillekitchensremodeling.com/ |
318 B 404 B |
Document
text/html |
||||||||||||||||||||||||||||||||||||||||||||||
General
Request headers
Response headers
|
Verdicts & Comments Add Verdict or Comment
0 JavaScript Global Variables
These are the non-standard "global" variables defined on the window object. These can be helpful in identifying possible client-side frameworks and code.
0 Cookies
Cookies are little pieces of information stored in the browser of a user. Whenever a user visits the site again, he will also send his cookie values, thus allowing the website to re-identify him even if he changed locations. This is how permanent logins work.
1 Console Messages
A page may trigger messages to the console to be logged. These are often error messages about being unable to load a resource or execute a piece of JavaScript. Sometimes they also provide insight into the technology behind a website.
Source | Level | URL Text |
---|
Indicators
This is a term in the security industry to describe indicators such as IPs, Domains, Hashes, etc. This does not imply that any of these indicate malicious activity.
discordbotshop.maplevillekitchensremodeling.com
173.254.28.225
b0c7e6712ecbf97a1e3a14f19e3aed5dbd6553f21a2852565bfc5518925713db