www.livelovelabelling.co.uk
Open in
urlscan Pro
54.154.42.22
Public Scan
URL:
https://www.livelovelabelling.co.uk/
Submission: On January 28 via api from US — Scanned from US
Submission: On January 28 via api from US — Scanned from US
Form analysis
1 forms found in the DOMGET https://www.livelovelabelling.co.uk/index.aspx?pageid=7670786
<form action="https://www.livelovelabelling.co.uk/index.aspx?pageid=7670786" method="get"><input name="pageid" id="pageid" type="hidden" value="7670786"><input name="chainID" id="chainID" type="hidden" value="737114">
<div class="search" data-editor-type="search">
<input id="txtQuickSearch" name="txtQuickSearch" placeholder="search" aria-label="search">
<button aria-label="search"><i class="fa fa-search" aria-hidden="true"></i></button>
</div>
</form>
Text Content
Menu HomeAboutCartContact Categories All Products Personalised Gifts Labels and Stickers Sanitiser Bottles Starbucks Cups Cards GBP AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL £0.00 My Account HomeAboutCartContact Categories All Products Personalised Gifts Labels and Stickers Sanitiser Bottles Starbucks Cups Cards * * 1. 1 2. 2 * < * > All Products Personalised Gifts Featured Products Bee Birthday Card £3.00 Giraffe Card £2.50 Hocus Pocus Cold Cup £12.99 Vinyl Cut Photo £15.00 Labels and Stickers Sanitiser Bottles Starbucks Cups Cards Welcome to Live Love Labelling! Here we believe in quality products that can help organise your home and repurpose and recycle products. We provide a variety of ready made personalised products as well as separated vinyl decals for you to apply yourself at home. And remember... Love your Label src="https://www.facebook.com/tr?id=563648864938101&ev=PageView&noscript=1" /> Store Links TermsPrivacySitemap Follow Us * * © 2024. Live Love Labelling | ie9+ | Free ecommerce shop uk MODAL DIALOG TITLE Modal Dialog Content Cancel Ok Create a free online store Powered by freewebstore.com Get your free online store today - Be your own boss! freewebstore Got a great business idea? Get a free online store just like this one! What do I get? Fully loaded webstore Unlimited products Domain & SSL checkout 24/7 support And more... Why freewebstore? 15+ years 1 million stores created No card required Easy to create What's the catch? Nope, no catch 0% commission Free forever! Premium upgrades available Get Started i ? Free UK eCommerce shop - click here freewebstore