www.cradle.bio
Open in
urlscan Pro
52.223.52.2
Public Scan
Submitted URL: https://click.convertkit-mail.com/zlu0we7xmpunh4g0nrxbzuwvl8000c6/qvh8h7hrkool9eug/aHR0cHM6Ly93d3cuY3JhZGxlLmJpby8=
Effective URL: https://www.cradle.bio/?utm_source=convertkit&utm_medium=email&utm_campaign=%E2%98%95%EF%B8%8F%20Nvidia%27s%20Latest%20...
Submission: On November 27 via api from RU — Scanned from DE
Effective URL: https://www.cradle.bio/?utm_source=convertkit&utm_medium=email&utm_campaign=%E2%98%95%EF%B8%8F%20Nvidia%27s%20Latest%20...
Submission: On November 27 via api from RU — Scanned from DE
Form analysis
0 forms found in the DOMText Content
PRODUCT TEAM BLOG PARTNERS CAREERS CONTACT SIGN IN Request invite NEW Cradle raises $73m Series B PROTEIN ENGINEERING WITHOUT THE GUESSWORK Design improved variants of your target protein sequence with just a few clicks — and some machine learning. Request invite Learn more TRUSTED BY * * * * * * * * * * * * * * * * * * * * * * * * * * * * TARGET PROTEIN SEQUENCE MLCDLKQGEPICVQKERKTPRDSGQQCHACIJKMGGHQ STABILITY ACTIVITY GENERATE VARIANTS Bring lab data or start fresh Get started by importing assay data from an ongoing project – or start fresh from just a single starting sequence. No surprises in the lab Each generated sequence comes with a predicted performance score. Less exciting for some, more productive for everyone. Reach objectives in half the time Cradle learns with every experimental round, giving you better variants each time – and dramatically cutting your time-to-market . Optimize everything at once Cradle lets you optimize multiple properties at once. You save time, the models learn faster. It’s a win-win. USED BY INDUSTRY LEADERS AND #BIONEERS The world’s leading biotech teams are using Cradle to accelerate new and ongoing projects – and to revisit challenging ones. * * * * * * * * * * * * * * * * * * * * * * * * MULTI-PROPERTY. NO-PROBLEM. Unlike traditional methods, Cradle is engineered to handle multiple properties and optimization tasks in a single round. Enzymes Vaccines Peptides Antibodies Activity Thermostability Solvent stability Solubility Substrate specificity Beta E-coli expression Beta MSTASGVEEQVIVNYQDSKNGYKIIKKATLWAFNRGVDWKFYKYLRGKQTYQCDLKQGIGTINRPEPTIDESKGVTVLIKRYLNFNAKPMRYFEKLDEEPGDKTYVTVLKKNGRKVMMFNTGVYEYKYLSVHQTYFRLFVNSHGRSLSGQAYNFGRGVCYNDNFQKGYMNGRNSYENVAHIFCICGNVPEVACCINESMSTASGVEEQVIVNYQDSKNGEPICVQKESWLWEVTGPYRINYPDRKKQVVYYKEMTQHTAKGSFQATSVDRKTPRDSGQQGYPCCPIMKISQDWTDKAIFSENGVYVRNIGTINRKGVTVLIKRYLENZYMESNFNAKPMRYFEKLDEEPGDKTYVFRLFVNSHGRSLSGQAYNFGRGVCYNDNFQKGYMNGRNSYENVAHIFCICGNVPEMSTASGVEEQVIVNYQDSKNGYKIIKKATLWAFNRGVDWKFYKYLRGKQTYQCDLKQGEPICVQKESWLWEVTGPYRINYPDRKKTQATSVDRKTPRDSGQQGYPCCPIMKISQDWTMDDANTIBODIESKAIFSNVYVRNYKIIKKATLWAFNRGVDWKFYKYLRGKQTYQCDLKQGEPICVQKESWLWEVTGPYRINYPDRKKQVVQDWTDKAIFSENGVYVRNIG PROTEINS ARE COMPLICATED. USING CRADLE IS NOT. We've designed Cradle to be as easy as possible to get started with – that means it fits right into your existing workflow. 1 Set up assays and objectives Getting started is easy, just tell Cradle what you plan to measure and where you want those measurements to go for your project to be successful. 2 Generate sequences 3 Test in lab 4 Import lab results PRIVATE. SECURE. YOURS. With Cradle, your sequences and data are kept private and secure while giving you full ownership of all intellectual property. Private by design Only you and people you invite can access your sequences and experimental data. Your data is never used to train models for other users. Safe & Secure Cradle uses bank-grade level of security to keep your data safe. Own your IP You own your IP. Royalties? Nope. With Cradle you pay a flat fee per year for using our tools for your project. SYENVAHIFCICGNVPEMSTASGVEEQVIVNYQDSKNGYKIIKKATLWAFNRGVDWKFYKYLRGKQTYQCDLKQGEPICVQKESWLWEVTGPYRINYPDRKKTQATSVDRKTPRDSGQQGYPCCPIMKISQDWTDAATNMODREAKAIFSENGVYVRNYKIIKKATLWAFNRGVDWKFYKYLRGKQTYQCDLKQGEPICVQKESWLWEVTGPYRINYPDRKKQVVQDWTDKAIFSENGVYVRNIGTINRKGVTVYYKEMTQHTAKGSFQATSVDQDWTDKAIFSENGVYVRNIGTINRKGVTVYYKEMTQHTAKGSFQATSVDYQCDLKQGEPICVQKESWLWEVTGPYRINMSTASGVEEQVIVNYQDSKNGYKIIKKATLWAFNRGVDWKFYKYLRGKQTYQCDLKQGIGTINRPSQTIDLSKGVTVLIKRYLNFNAKPMRYFEKLDEEPGDKTYVTVLKKNGRKVMMFNNFNAKPMRYFEKLDEEPGDKT GKQTYQCDLKQGEPICVQKESWLWEVTGPYRINYPDRKKTQATSVDRKTPRDSGQQGYPCCPIMKISQDWTDAATNMDLKQGEPICVQKESWLWEVTGPYRINYPDRKKQVVQDWTDKAIFSENGVYVRNIGTINRKGVTVYYKE THE TEAM At Cradle we believe biology can theoretically be used to produce almost anything, from therapeutics to chemicals, materials and food. Designing proteins is not easy, but with our tools and machine learning models we are changing that. Meet the team Careers Summer offsite Stef at CogX Co-working week Lab day for ML team NEW Cradle raises $73m Series B BACKED BY THE BEST We are funded by leading investors IVP, Index Ventures, and Kindred Capital, as well as long list of world-class advisors and angel investors IVP IVP have helped grow breakout like companies Slack, Netflix, Github and many others into enduring market leaders. Index Ventures Index helps entrepreneurs turn bold ideas into businesses that have a long-lasting positive impact on the world. Kindred Capital Kindred is an early investor in LabGenius, Ori, Eleven Tx, and others. Emily Leproust CEO at Twist Biosciences Steve Crossan SVP AI at GSK, former Head of Product at Google Deepmind and co-founder of Alphafold project Adriaan Mol Founder at Mollie & Messagebird John Zimmer CEO & Founder at Lyft Tim Geistlinger Chief Scientific Officer at Perfect Day Mehdi Ghissassi Director of Product at Google Deepmind Patrick Hsu Professor at Berkley & Founder of Arc Institute Feike Sijbesma Honorary Chairman and former CEO at Royal DSM Sylvain Gariel Founder & COO at DNA Script Chris Gibson Co-founder & CEO at Recursion Tom Glocer Former CEO of Thomson Reuters and Lead Director at Merck Project lead Protein engineer Bioinformatician READY TO TRY CRADLE? Join the world's leading biotech teams and request your early access invite today. Request invite BLOG CAREERS DOCS PRESS KIT LINKEDIN Built with ❤️ in Amsterdam & Zurich TERMS OF SERVICE PRIVACY POLICY SECURITY © 2024 · CRADLE IS A REGISTERED TRADEMARK