13.testfamilygarden.su Open in urlscan Pro
2a00:f940:2:2:1:3:0:216 Public Scan

Go To Rescan
Add Verdict Report

URL:
https://13.testfamilygarden.su/
Submission: On April 05 via api (April 5th 2024, 12:41:57 pm UTC) from US — Scanned from US

Summary HTTP 233 Redirects Links 36 Behaviour Indicators

Summary

This website contacted 12 IPs in 3 countries across 10 domains to perform 233 HTTP transactions. The main IP is 2a00:f940:2:2:1:3:0:216, located in Russian Federation and belongs to AS-REG, RU. The main domain is 13.testfamilygarden.su.
TLS certificate: Issued by prohinkalimsc.testfamilygarden.su on March 21st 2024. Valid for: a year.

This is the only time 13.testfamilygarden.su was scanned on urlscan.io!

urlscan.io Verdict: No classification

Domain & IP information

	IP Address	AS Autonomous System
174	2a00:f940:2:2... 2a00:f940:2:2:1:3:0:216	197695 (AS-REG) (AS-REG)
2	142.251.35.164 142.251.35.164	15169 (GOOGLE) (GOOGLE)
6	2a02:6b8::274 2a02:6b8::274	13238 (YANDEX) (YANDEX)
1	2607:f8b0:400... 2607:f8b0:4006:81c::2008	15169 (GOOGLE) (GOOGLE)
2	52.209.148.209 52.209.148.209	16509 (AMAZON-02) (AMAZON-02)
1	2607:f8b0:400... 2607:f8b0:4006:822::2003	15169 (GOOGLE) (GOOGLE)
1	2a02:6b8:20::215 2a02:6b8:20::215	13238 (YANDEX) (YANDEX)
3 10	2a02:6b8::1:119 2a02:6b8::1:119	13238 (YANDEX) (YANDEX)
1	2607:f8b0:400... 2607:f8b0:4006:823::200e	15169 (GOOGLE) (GOOGLE)
6	2a02:6b8:a::a 2a02:6b8:a::a	13238 (YANDEX) (YANDEX)
32	2a02:6b8::2b8 2a02:6b8::2b8	13238 (YANDEX) (YANDEX)
233	12

174 2a00:f940:2:2:1:3:0:216 (Russian Federation)

ASN197695 (AS-REG, RU)

13.testfamilygarden.su	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools
testfamilygarden.su	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

2 142.251.35.164 (Queens, United States)

ASN15169 (GOOGLE, US)
PTR: lga25s78-in-f4.1e100.net

www.google.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

6 2a02:6b8::274 (Russian Federation)

ASN13238 (YANDEX, RU)

api-maps.yandex.ru	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

1 2607:f8b0:4006:81c::2008 (United States)

ASN15169 (GOOGLE, US)

www.googletagmanager.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

2 52.209.148.209 (Dublin, Ireland)

ASN16509 (AMAZON-02, US)
PTR: ec2-52-209-148-209.eu-west-1.compute.amazonaws.com

bitrix.info	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

1 2607:f8b0:4006:822::2003 (United States)

ASN15169 (GOOGLE, US)

www.gstatic.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

1 2a02:6b8:20::215 (Russian Federation)

ASN13238 (YANDEX, RU)

yastatic.net	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

10 2a02:6b8::1:119 (Russian Federation) 3 redirects

ASN13238 (YANDEX, RU)

mc.yandex.ru	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools
mc.yandex.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

1 2607:f8b0:4006:823::200e (United States)

ASN15169 (GOOGLE, US)

www.google-analytics.com	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

6 2a02:6b8:a::a (Russian Federation)

ASN13238 (YANDEX, RU)

yandex.ru	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

32 2a02:6b8::2b8 (Russian Federation)

ASN13238 (YANDEX, RU)

core-renderer-tiles.maps.yandex.net	Domain lookup VirusTotal SecurityTrails crt.sh Censys Domaintools

	Apex Domain Subdomains	Transfer
174	testfamilygarden.su 13.testfamilygarden.su testfamilygarden.su	13 MB
32	yandex.net core-renderer-tiles.maps.yandex.net — Cisco Umbrella Rank: 52238	368 KB
14	yandex.ru 1 redirects api-maps.yandex.ru — Cisco Umbrella Rank: 44678 mc.yandex.ru — Cisco Umbrella Rank: 4290 yandex.ru — Cisco Umbrella Rank: 2000	90 KB
8	yandex.com 2 redirects mc.yandex.com — Cisco Umbrella Rank: 9289	5 KB
2	bitrix.info bitrix.info — Cisco Umbrella Rank: 54613	4 KB
2	google.com www.google.com — Cisco Umbrella Rank: 2	883 B
1	google-analytics.com www.google-analytics.com — Cisco Umbrella Rank: 35	259 B
1	yastatic.net yastatic.net — Cisco Umbrella Rank: 7126	676 KB
1	gstatic.com www.gstatic.com	199 KB
1	googletagmanager.com www.googletagmanager.com — Cisco Umbrella Rank: 43	94 KB
233	10

	Domain	Requested by
173	13.testfamilygarden.su	13.testfamilygarden.su
32	core-renderer-tiles.maps.yandex.net	13.testfamilygarden.su
8	mc.yandex.com	2 redirects 13.testfamilygarden.su mc.yandex.ru
6	yandex.ru	13.testfamilygarden.su
6	api-maps.yandex.ru	13.testfamilygarden.su yastatic.net
2	mc.yandex.ru	1 redirects 13.testfamilygarden.su
2	bitrix.info	13.testfamilygarden.su bitrix.info
2	www.google.com	13.testfamilygarden.su www.gstatic.com
1	www.google-analytics.com	www.googletagmanager.com
1	yastatic.net	api-maps.yandex.ru
1	www.gstatic.com	www.google.com
1	testfamilygarden.su	13.testfamilygarden.su
1	www.googletagmanager.com	13.testfamilygarden.su
233	13

This site contains links to these domains. Also see Links.

Domain
familygardengroup.ru
vinograd.testfamilygardengroup.su
mandarin.testfamilygardengroup.su
v.testfamilygardengroup.su
uzhanintashkent.testfamilygardengroup.su
prohinkalykrilatskoe.testfamilygardengroup.su
sorrentokp.testfamilygardengroup.su
promeat.testfamilygardengroup.su
sorrento.testfamilygardengroup.su
grekos.testfamilygardengroup.su
medusa.testfamilygardengroup.su
13.testfamilygardengroup.su
syrovarnyasochi.testfamilygardengroup.su
syrovarnyamsc.testfamilygardengroup.su
syrovarnyakrd.testfamilygardengroup.su
syrovarnyakp.testfamilygardengroup.su
syrovarnyaadler.testfamilygardengroup.su
syrovarnyatashkent.testfamilygardengroup.su
injirsochi.testfamilygardengroup.su
injirdmitrovskaya.testfamilygardengroup.su
injirbratislavskaya.testfamilygardengroup.su
injirkomsomolskaya.testfamilygardengroup.su
prohinkalimsc.testfamilygardengroup.su
prohinkalytashkent.testfamilygardengroup.su
prohinkalikrd.testfamilygardengroup.su
prohinkalycheremushki.testfamilygardengroup.su
prohinkalipaveleckaya.testfamilygardengroup.su
klevokrd.testfamilygardengroup.su
uzhaninkrd.testfamilygardengroup.su
luckydze.testfamilygardengroup.su
yandex.ru
tech.yandex.ru
t.me
instagram.com
maxistudio.pro
novoxpro.ru

Subject Issuer	Validity	Valid
prohinkalimsc.testfamilygarden.su prohinkalimsc.testfamilygarden.su	`2024-03-21` - `2025-03-20`	a year	crt.sh
*.google.com GTS CA 1C3	`2024-03-04` - `2024-05-27`	3 months	crt.sh
api-maps.yandex.ru GlobalSign RSA OV SSL CA 2018	`2023-11-25` - `2024-05-20`	6 months	crt.sh
*.google-analytics.com GTS CA 1C3	`2024-03-04` - `2024-05-27`	3 months	crt.sh
*.bitrix.info Go Daddy Secure Certificate Authority - G2	`2024-03-19` - `2025-04-20`	a year	crt.sh
testfamilygarden.su testfamilygarden.su	`2024-03-21` - `2025-03-20`	a year	crt.sh
*.gstatic.com GTS CA 1C3	`2024-03-04` - `2024-05-27`	3 months	crt.sh
*.yastatic-net.ru GlobalSign ECC OV SSL CA 2018	`2023-12-13` - `2024-06-11`	6 months	crt.sh
mc.yandex.ru GlobalSign ECC OV SSL CA 2018	`2023-12-26` - `2024-06-05`	5 months	crt.sh
*.xn--d1acpjx3f.xn--p1ai GlobalSign ECC OV SSL CA 2018	`2024-03-04` - `2024-09-01`	6 months	crt.sh
*.core-renderer-tiles.maps.yandex.net GlobalSign RSA OV SSL CA 2018	`2024-01-16` - `2024-07-16`	6 months	crt.sh

This page contains 2 frames:

Primary Page: https://13.testfamilygarden.su/
Frame ID: 4C047D1D29795D5421527CEC981023A4
Requests: 236 HTTP requests in this frame

Frame: https://www.google.com/recaptcha/api2/anchor?ar=1&k=6Lf126cgAAAAAIJ3Urzqt0wmrtyVXcweVwd9z8y5&co=aHR0cHM6Ly8xMy50ZXN0ZmFtaWx5Z2FyZGVuLnN1OjQ0Mw..&hl=en&v=moV1mTgQ6S91nuTnmll4Y9yf&size=invisible&cb=ssx0sg4j8mrx
Frame ID: B0AE23206AFAA8AFA5EC36227FD7BDCC
Requests: 1 HTTP requests in this frame

Screenshot
Live screenshot

Full Image

Page Title

Ресторан №13 в Сочи на Мандарине. Авторская кухня, бронирование столов, меню, цены, доставка еды | Официальный сайт • 13

Detected technologies

Bootstrap (Web Frameworks) Expand

Overall confidence: 100%
Detected patterns

<link[^>]* href=[^>]*?bootstrap(?:[^>]*?([0-9a-fA-F]{7,40}|[\d]+(?:.[\d]+(?:.[\d]+)?)?)|)[^>]*?(?:\.min)?\.css

Google Analytics (Analytics) Expand

Overall confidence: 100%
Detected patterns

Google Tag Manager (Tag Managers) Expand

Overall confidence: 100%
Detected patterns

googletagmanager\.com/gtag/js

Mautic (Marketing Automation) Expand

Overall confidence: 100%
Detected patterns

[^a-z]mtc.*\.js

Yandex.Metrika (Analytics) Expand

Overall confidence: 100%
Detected patterns

mc\.yandex\.ru/metrika/(?:tag|watch)\.js

jQuery (JavaScript Libraries) Expand

Overall confidence: 100%
Detected patterns

jquery.*\.js(?:\?ver(?:sion)?=([\d.]+))?

reCAPTCHA (Captchas) Expand

Overall confidence: 100%
Detected patterns

/recaptcha/api\.js

Page Statistics

233
Requests

24 %
HTTPS

82 %
IPv6

10
Domains

13
Subdomains

12
IPs

3
Countries

15143 kB
Transfer

19034 kB
Size

30
Cookies

36 Outgoing links

These are links going to different origins than the main page.

URL: https://familygardengroup.ru/
Title: Главная

Search URL Search Domain Scan URL

URL: http://vinograd.testfamilygardengroup.su/reservation/
Title: Забронировать

Search URL Search Domain Scan URL

URL: http://mandarin.testfamilygardengroup.su/reservation/
Title: Забронировать

Search URL Search Domain Scan URL

URL: http://v.testfamilygardengroup.su/reservation/
Title: Забронировать

Search URL Search Domain Scan URL

URL: http://uzhanintashkent.testfamilygardengroup.su/reservation/
Title: Забронировать

Search URL Search Domain Scan URL

URL: http://prohinkalykrilatskoe.testfamilygardengroup.su/reservation/
Title: Забронировать

Search URL Search Domain Scan URL

URL: http://sorrentokp.testfamilygardengroup.su/reservation/
Title: Забронировать

Search URL Search Domain Scan URL

URL: http://promeat.testfamilygardengroup.su/reservation/
Title: Забронировать

Search URL Search Domain Scan URL

URL: http://sorrento.testfamilygardengroup.su/reservation/
Title: Забронировать

Search URL Search Domain Scan URL

URL: http://grekos.testfamilygardengroup.su/reservation/
Title: Забронировать

Search URL Search Domain Scan URL

URL: http://medusa.testfamilygardengroup.su/reservation/
Title: Забронировать

Search URL Search Domain Scan URL

URL: http://13.testfamilygardengroup.su/reservation/
Title: Забронировать

Search URL Search Domain Scan URL

URL: http://syrovarnyasochi.testfamilygardengroup.su/reservation/
Title: Забронировать

Search URL Search Domain Scan URL

URL: http://syrovarnyamsc.testfamilygardengroup.su/reservation/
Title: Забронировать

Search URL Search Domain Scan URL

URL: http://syrovarnyakrd.testfamilygardengroup.su/reservation/
Title: Забронировать

Search URL Search Domain Scan URL

URL: http://syrovarnyakp.testfamilygardengroup.su/reservation/
Title: Забронировать

Search URL Search Domain Scan URL

URL: http://syrovarnyaadler.testfamilygardengroup.su/reservation/
Title: Забронировать

Search URL Search Domain Scan URL

URL: http://syrovarnyatashkent.testfamilygardengroup.su/reservation/
Title: Забронировать

Search URL Search Domain Scan URL

URL: http://injirsochi.testfamilygardengroup.su/reservation/
Title: Забронировать

Search URL Search Domain Scan URL

URL: http://injirdmitrovskaya.testfamilygardengroup.su/reservation/
Title: Забронировать

Search URL Search Domain Scan URL

URL: http://injirbratislavskaya.testfamilygardengroup.su/reservation/
Title: Забронировать

Search URL Search Domain Scan URL

URL: http://injirkomsomolskaya.testfamilygardengroup.su/reservation/
Title: Забронировать

Search URL Search Domain Scan URL

URL: http://prohinkalimsc.testfamilygardengroup.su/reservation/
Title: Забронировать

Search URL Search Domain Scan URL

URL: http://prohinkalytashkent.testfamilygardengroup.su/reservation/
Title: Забронировать

Search URL Search Domain Scan URL

URL: http://prohinkalikrd.testfamilygardengroup.su/reservation/
Title: Забронировать

Search URL Search Domain Scan URL

URL: http://prohinkalycheremushki.testfamilygardengroup.su/reservation/
Title: Забронировать

Search URL Search Domain Scan URL

URL: http://prohinkalipaveleckaya.testfamilygardengroup.su/reservation/
Title: Забронировать

Search URL Search Domain Scan URL

URL: http://klevokrd.testfamilygardengroup.su/reservation/
Title: Забронировать

Search URL Search Domain Scan URL

URL: http://uzhaninkrd.testfamilygardengroup.su/reservation/
Title: Забронировать

Search URL Search Domain Scan URL

URL: http://luckydze.testfamilygardengroup.su/reservation/
Title: Забронировать

Search URL Search Domain Scan URL

URL: https://yandex.ru/legal/maps_termsofuse/?lang=ru
Title: Условия использования

Search URL Search Domain Scan URL

URL: https://tech.yandex.ru/maps/mapsapi/?from=api-maps
Title: Создать свою карту

Search URL Search Domain Scan URL

URL: https://t.me/familygardengroup

Search URL Search Domain Scan URL

URL: https://instagram.com/13Sochi

Search URL Search Domain Scan URL

URL: http://maxistudio.pro/
Title: Maxi Studio

Search URL Search Domain Scan URL

URL: http://novoxpro.ru/
Title: Novox Pro

Search URL Search Domain Scan URL

Redirected requests

There were HTTP redirect chains for the following requests:

Request Chain 180

https://mc.yandex.com/sync_cookie_image_check HTTP 302
https://mc.yandex.ru/sync_cookie_image_start?redirect_domain=mc.yandex.com&token=10330.b9oCx27y4EbwoW8lfjzo2p08P_ETxek2C14kbzPaXEoeJ7fH4NlGOfk9Tf7kXmLE.4v_PEwi5mCO3X66s5py5iIeWTlw%2C HTTP 302
https://mc.yandex.com/sync_cookie_image_decide?token=10330.xWOtNIkA05AhPbY-cPAgSUaUpx77BRfu3AY9862Sp1QYhKVhfPcsra86J9gohz5-skDoHac1wvBTu4k20hnhB78hOiAeoe8N6IfghotypXNb2kYlow_R_w7pwDQQY94TeAjY6LfCzDSfENwhWan0mX4-7MQJLh82AEplMCX29sR9Tb33IU-KY92bsQI9B_jOkUt4tV4Tuo_IIGlO41BPDJSbj3GMTg7ttgQD7_zXJRU%2C.ZGz4GkdT8FrjdGF-9OavmBvLfZ8%2C

Request Chain 186

https://mc.yandex.com/watch/89347546?wmode=7&page-url=https%3A%2F%2F13.testfamilygarden.su%2F&charset=utf-8&uah=chu%0A%22Google%20Chrome%22%3Bv%3D%22123%22%2C%22Not%3AA-Brand%22%3Bv%3D%228%22%2C%22Chromium%22%3Bv%3D%22123%22%0Acha%0Ax86%0Achb%0A64%0Achf%0A123.0.6312.105%0Achl%0A%22Google%20Chrome%22%3Bv%3D%22123.0.6312.105%22%2C%22Not%3AA-Brand%22%3Bv%3D%228.0.0.0%22%2C%22Chromium%22%3Bv%3D%22123.0.6312.105%22%0Achm%0A%3F0%0Achp%0AWin32%0Achv%0A10.0.0&browser-info=pv%3A1%3Avf%3A6q5vo8idydw3m5q59jr2ws8gr%3Afu%3A0%3Aen%3Autf-8%3Ala%3Aen-US%3Av%3A1290%3Acn%3A1%3Adp%3A0%3Als%3A1670844702263%3Ahid%3A748472765%3Az%3A-600%3Ai%3A20240405024149%3Aet%3A1712320909%3Ac%3A1%3Arn%3A947008341%3Arqn%3A1%3Au%3A1712320909960520166%3Aw%3A1600x1113%3As%3A800x600x24%3Ask%3A1%3Afp%3A2703%3Awv%3A2%3Ads%3A0%2C345%2C1068%2C2%2C0%2C0%2C%2C1050%2C1%2C%2C%2C%2C3011%3Aco%3A0%3Acpf%3A1%3Ans%3A1712320905175%3Agi%3AR0ExLjEuMTQ5MzcxMDA3My4xNzEyMzIwOTA4%3Aadb%3A2%3Arqnl%3A1%3Ast%3A1712320910%3At%3A%D0%A0%D0%B5%D1%81%D1%82%D0%BE%D1%80%D0%B0%D0%BD%20%E2%84%9613%20%D0%B2%20%D0%A1%D0%BE%D1%87%D0%B8%20%D0%BD%D0%B0%20%D0%9C%D0%B0%D0%BD%D0%B4%D0%B0%D1%80%D0%B8%D0%BD%D0%B5.%20%D0%90%D0%B2%D1%82%D0%BE%D1%80%D1%81%D0%BA%D0%B0%D1%8F%20%D0%BA%D1%83%D1%85%D0%BD%D1%8F%2C%20%D0%B1%D1%80%D0%BE%D0%BD%D0%B8%D1%80%D0%BE%D0%B2%D0%B0%D0%BD%D0%B8%D0%B5%20%D1%81%D1%82%D0%BE%D0%BB%D0%BE%D0%B2%2C%20%D0%BC%D0%B5%D0%BD%D1%8E%2C%20%D1%86%D0%B5%D0%BD%D1%8B%2C%20%D0%B4%D0%BE%D1%81%D1%82%D0%B0%D0%B2%D0%BA%D0%B0%20%D0%B5%D0%B4%D1%8B%20%7C%20%D0%9E%D1%84%D0%B8%D1%86%D0%B8%D0%B0%D0%BB%D1%8C%D0%BD%D1%8B%D0%B9%20%D1%81%D0%B0%D0%B9%D1%82%20%E2%80%A2%2013&t=gdpr(14)clc(0-0-0)rqnt(1)eco(21037572)aw(1)rcm(1)cdl(na)ti(1) HTTP 302
https://mc.yandex.com/watch/89347546/1?wmode=7&page-url=https%3A%2F%2F13.testfamilygarden.su%2F&charset=utf-8&uah=chu%0A%22Google%20Chrome%22%3Bv%3D%22123%22%2C%22Not%3AA-Brand%22%3Bv%3D%228%22%2C%22Chromium%22%3Bv%3D%22123%22%0Acha%0Ax86%0Achb%0A64%0Achf%0A123.0.6312.105%0Achl%0A%22Google%20Chrome%22%3Bv%3D%22123.0.6312.105%22%2C%22Not%3AA-Brand%22%3Bv%3D%228.0.0.0%22%2C%22Chromium%22%3Bv%3D%22123.0.6312.105%22%0Achm%0A%3F0%0Achp%0AWin32%0Achv%0A10.0.0&browser-info=pv%3A1%3Avf%3A6q5vo8idydw3m5q59jr2ws8gr%3Afu%3A0%3Aen%3Autf-8%3Ala%3Aen-US%3Av%3A1290%3Acn%3A1%3Adp%3A0%3Als%3A1670844702263%3Ahid%3A748472765%3Az%3A-600%3Ai%3A20240405024149%3Aet%3A1712320909%3Ac%3A1%3Arn%3A947008341%3Arqn%3A1%3Au%3A1712320909960520166%3Aw%3A1600x1113%3As%3A800x600x24%3Ask%3A1%3Afp%3A2703%3Awv%3A2%3Ads%3A0%2C345%2C1068%2C2%2C0%2C0%2C%2C1050%2C1%2C%2C%2C%2C3011%3Aco%3A0%3Acpf%3A1%3Ans%3A1712320905175%3Agi%3AR0ExLjEuMTQ5MzcxMDA3My4xNzEyMzIwOTA4%3Aadb%3A2%3Arqnl%3A1%3Ast%3A1712320910%3At%3A%D0%A0%D0%B5%D1%81%D1%82%D0%BE%D1%80%D0%B0%D0%BD%20%E2%84%9613%20%D0%B2%20%D0%A1%D0%BE%D1%87%D0%B8%20%D0%BD%D0%B0%20%D0%9C%D0%B0%D0%BD%D0%B4%D0%B0%D1%80%D0%B8%D0%BD%D0%B5.%20%D0%90%D0%B2%D1%82%D0%BE%D1%80%D1%81%D0%BA%D0%B0%D1%8F%20%D0%BA%D1%83%D1%85%D0%BD%D1%8F%2C%20%D0%B1%D1%80%D0%BE%D0%BD%D0%B8%D1%80%D0%BE%D0%B2%D0%B0%D0%BD%D0%B8%D0%B5%20%D1%81%D1%82%D0%BE%D0%BB%D0%BE%D0%B2%2C%20%D0%BC%D0%B5%D0%BD%D1%8E%2C%20%D1%86%D0%B5%D0%BD%D1%8B%2C%20%D0%B4%D0%BE%D1%81%D1%82%D0%B0%D0%B2%D0%BA%D0%B0%20%D0%B5%D0%B4%D1%8B%20%7C%20%D0%9E%D1%84%D0%B8%D1%86%D0%B8%D0%B0%D0%BB%D1%8C%D0%BD%D1%8B%D0%B9%20%D1%81%D0%B0%D0%B9%D1%82%20%E2%80%A2%2013&t=gdpr%2814%29clc%280-0-0%29rqnt%281%29eco%2821037572%29aw%281%29rcm%281%29cdl%28na%29ti%281%29

233 HTTP transactions
4 data transactions

Method
Protocol Status Resource
Path Size
x-fer Time
Latency Type
MIME-Type IP
Location

GET
H2 200 Primary Request / Show response
13.testfamilygarden.su/ 156 KB
28 KB 1940ms
1068ms Document
text/html 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to

Full URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx / PHP/7.4.33
Resource Hash: b02d015f4b201ec844118a0fdf3b347bb10c3c39932333379cc6aa20b52bef69

Request headers

Upgrade-Insecure-Requests: 1
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
accept-language: en-US,en;q=0.9
sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
sec-ch-ua-mobile: ?0
sec-ch-ua-platform: "Win32"

Response headers

cache-control: no-store, no-cache, must-revalidate
content-encoding: gzip
content-type: text/html; charset=UTF-8
date: Fri, 05 Apr 2024 12:41:46 GMT
expires: Thu, 19 Nov 1981 08:52:00 GMT
p3p: policyref="/bitrix/p3p.xml", CP="NON DSP COR CUR ADM DEV PSA PSD OUR UNR BUS UNI COM NAV INT DEM STA"
pragma: no-cache
server: nginx
vary: Accept-Encoding
x-devsrv-cms: Bitrix
x-powered-by: PHP/7.4.33
x-powered-cms: Bitrix Site Manager (7e683df94889b2cec79b7292a3574edf)

GET
H2 200 page_4684ee6cbc3e1b1a1a5a18f796609748_v1.css
13.testfamilygarden.su/bitrix/cache/css/f9/injir_dev/page_4684ee6cbc3e1b1a1a5a18f796609748/ 1 KB
1 KB 163ms
154ms Stylesheet
text/css 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to

Full URL: https://13.testfamilygarden.su/bitrix/cache/css/f9/injir_dev/page_4684ee6cbc3e1b1a1a5a18f796609748/page_4684ee6cbc3e1b1a1a5a18f796609748_v1.css?17104863291036
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 11044a657158195c5a7669465a611336c670bbb95055953cc3fc60ab79831f8e

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Fri, 15 Mar 2024 07:05:29 GMT
server: nginx
etag: "65f3f339-40c"
content-type: text/css
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 1036
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 template_39a4c9af70bcfceb5182b8f816975417_v1.css
13.testfamilygarden.su/bitrix/cache/css/f9/injir_dev/template_39a4c9af70bcfceb5182b8f816975417/ 4 KB
1 KB 164ms
155ms Stylesheet
text/css 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to

Full URL: https://13.testfamilygarden.su/bitrix/cache/css/f9/injir_dev/template_39a4c9af70bcfceb5182b8f816975417/template_39a4c9af70bcfceb5182b8f816975417_v1.css?17104863294226
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 95e65dc8cda3b25ca96701386e7de9af82960b1fe88273275462eae7ff930ef7

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
content-encoding: gzip
last-modified: Fri, 15 Mar 2024 07:05:29 GMT
server: nginx
etag: W/"65f3f339-1082"
vary: Accept-Encoding
content-type: text/css
cache-control: max-age=3888000
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 bootstrap.min.css
13.testfamilygarden.su/local/templates/injir_dev/css/libraries/ 157 KB
23 KB 172ms
164ms Stylesheet
text/css 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to

Full URL: https://13.testfamilygarden.su/local/templates/injir_dev/css/libraries/bootstrap.min.css
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 680af6669abc319f9803f0fa26d443df1b6bc29133d88a8e4bea560ffed7288c

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
content-encoding: gzip
last-modified: Wed, 13 Mar 2024 12:35:48 GMT
server: nginx
etag: W/"65f19da4-27293"
vary: Accept-Encoding
content-type: text/css
cache-control: max-age=3888000
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 nice-select.css
13.testfamilygarden.su/local/templates/injir_dev/css/libraries/ 4 KB
1 KB 170ms
165ms Stylesheet
text/css 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to

Full URL: https://13.testfamilygarden.su/local/templates/injir_dev/css/libraries/nice-select.css
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: c13280e79f74109c5e3854822c0f0c972d0a57245c95b0b3762f9788bd918f8d

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
content-encoding: gzip
last-modified: Wed, 13 Mar 2024 12:35:48 GMT
server: nginx
etag: W/"65f19da4-fa7"
vary: Accept-Encoding
content-type: text/css
cache-control: max-age=3888000
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 slick.css
13.testfamilygarden.su/local/templates/injir_dev/css/libraries/ 2 KB
752 B 171ms
166ms Stylesheet
text/css 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to

Full URL: https://13.testfamilygarden.su/local/templates/injir_dev/css/libraries/slick.css
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: de1e399b07289f3b0a8d35142e363e128124a1185770e214e25e58030dad48e5

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
content-encoding: gzip
last-modified: Wed, 13 Mar 2024 12:35:48 GMT
server: nginx
etag: W/"65f19da4-6f0"
vary: Accept-Encoding
content-type: text/css
cache-control: max-age=3888000
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 air-datepicker.min.css
13.testfamilygarden.su/local/templates/injir_dev/css/libraries/ 19 KB
4 KB 171ms
166ms Stylesheet
text/css 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to

Full URL: https://13.testfamilygarden.su/local/templates/injir_dev/css/libraries/air-datepicker.min.css
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 386035e521437e06d2f2de96283b7a515c50520ac2678a37743e7be0b95a4883

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
content-encoding: gzip
last-modified: Wed, 13 Mar 2024 12:35:48 GMT
server: nginx
etag: W/"65f19da4-4d94"
vary: Accept-Encoding
content-type: text/css
cache-control: max-age=3888000
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 jquery.fancybox.css
13.testfamilygarden.su/local/templates/injir_dev/css/libraries/ 17 KB
4 KB 339ms
335ms Stylesheet
text/css 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to

Full URL: https://13.testfamilygarden.su/local/templates/injir_dev/css/libraries/jquery.fancybox.css
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 3fc93cc3f2dec261a4dbd670cfcf476a15f759d6b9066f30bb65e4082d032fdb

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
content-encoding: gzip
last-modified: Wed, 13 Mar 2024 12:35:48 GMT
server: nginx
etag: W/"65f19da4-4404"
vary: Accept-Encoding
content-type: text/css
cache-control: max-age=3888000
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 style.css
13.testfamilygarden.su/local/templates/injir_dev/css/ 96 KB
16 KB 340ms
336ms Stylesheet
text/css 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to

Full URL: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 65b6956a9126d7fd8afef3424837979dcaa0f2ac737339a745dbaefcd672dd39

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
content-encoding: gzip
last-modified: Wed, 13 Mar 2024 12:35:48 GMT
server: nginx
etag: W/"65f19da4-17ff7"
vary: Accept-Encoding
content-type: text/css
cache-control: max-age=3888000
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 logo.png
13.testfamilygarden.su/local/templates/injir_dev/img/ 7 KB
7 KB 340ms
336ms Image
image/png 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/local/templates/injir_dev/img/logo.png
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 33b1f5cdacaf3a1c654bd220a4817c1395138b336fa519ab9963da0da48150ab

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:35:48 GMT
server: nginx
etag: "65f19da4-1aef"
content-type: image/png
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 6895
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 6ildpsuh5xpe6cf4x0ww8mlv8250ncfh.png
13.testfamilygarden.su/upload/resize_cache/iblock/f46/500_1000_1/ 13 KB
13 KB 340ms
336ms Image
image/png 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/f46/500_1000_1/6ildpsuh5xpe6cf4x0ww8mlv8250ncfh.png
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: ba6cf5f96ee234596479b7b93d4568c36363e2d2e1084cc0d375d4cfe9d41f53

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Fri, 15 Mar 2024 07:05:29 GMT
server: nginx
etag: "65f3f339-3523"
content-type: image/png
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 13603
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 tio267txbk3lr8ynbuama4pzhkx35xb2.jpg
13.testfamilygarden.su/upload/iblock/8fe/ 181 KB
181 KB 269ms
160ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/iblock/8fe/tio267txbk3lr8ynbuama4pzhkx35xb2.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 9b56ca6f6260ac29ca3de8bb2185c38e191777da35b76783ac3f4f669e23e5c2

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:38:37 GMT
server: nginx
etag: "65f19e4d-2d35f"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 185183
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 wzum691oybd9uhe948jr54jncawqspld.png
13.testfamilygarden.su/upload/iblock/89a/ 394 KB
395 KB 269ms
161ms Image
image/png 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/iblock/89a/wzum691oybd9uhe948jr54jncawqspld.png
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: df8e0e20eb7a96f90a3a9aba2402326bcff91df3f20be86b9965052c7276f9f6

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:38:55 GMT
server: nginx
etag: "65f19e5f-628fd"
content-type: image/png
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 403709
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 arwh6ejwo8bfbazepwsuqp9ew24i8r0l.jpeg
13.testfamilygarden.su/upload/resize_cache/iblock/f30/10000_500_1/ 391 KB
392 KB 269ms
161ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/f30/10000_500_1/arwh6ejwo8bfbazepwsuqp9ew24i8r0l.jpeg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 084df7cc48429dba4c355a61abeec3f6e94a6c92978066c87b96bf273655f467

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Fri, 15 Mar 2024 07:05:29 GMT
server: nginx
etag: "65f3f339-61cd3"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 400595
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 2jvo1d5ij0qlbhoyh4fhfcffffh7zjm8.JPG
13.testfamilygarden.su/upload/resize_cache/iblock/985/800_10000_1/ 117 KB
117 KB 272ms
169ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/985/800_10000_1/2jvo1d5ij0qlbhoyh4fhfcffffh7zjm8.JPG
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 3ce1ebc4d7fd55b99e3c4b11fee7fe6a6cb1d8057adae61428ab79ac95e85b4c

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:33 GMT
server: nginx
etag: "65f19fed-1d437"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 119863
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 5rsidku3xib1pta7zy2uotcdmhi2u4g5.JPG
13.testfamilygarden.su/upload/resize_cache/iblock/127/800_10000_1/ 121 KB
121 KB 272ms
169ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/127/800_10000_1/5rsidku3xib1pta7zy2uotcdmhi2u4g5.JPG
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 2a3d54ca32dbcd0df2887b44eda24da2a86408fd57715de8ea10b06af4c13931

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:34 GMT
server: nginx
etag: "65f19fee-1e33f"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 123711
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 bik3l2q9dq02drprvp2m9p042q15dai8.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/daa/800_10000_1/ 120 KB
120 KB 272ms
157ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/daa/800_10000_1/bik3l2q9dq02drprvp2m9p042q15dai8.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: acbe01e0faa5e400651f4e7ac2cc85d50a8763db66412ebb9eb459828861df41

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:34 GMT
server: nginx
etag: "65f19fee-1df5d"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 122717
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 p2yofebcfz8gh9z7laui003mo9wa4tvv.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/794/800_10000_1/ 129 KB
129 KB 273ms
157ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/794/800_10000_1/p2yofebcfz8gh9z7laui003mo9wa4tvv.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: cdaba1a2e0e1bc47de694a2b83beabb53eecca62dd8faefd0861db49d369b9ce

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:35 GMT
server: nginx
etag: "65f19fef-2027d"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 131709
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 0bo68sft4s0wn1kfgd8br526i69pu4mf.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/6fa/800_10000_1/ 94 KB
94 KB 273ms
158ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/6fa/800_10000_1/0bo68sft4s0wn1kfgd8br526i69pu4mf.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: ad4edfb87b2f0f1f9fdf6338fdb26e5aa669dd85b54c46422cf89f9f0ff17dd8

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:35 GMT
server: nginx
etag: "65f19fef-1765f"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 95839
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 ui8ko1h1l2hqxnfjhronlt6gnxs73488.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/0eb/800_10000_1/ 127 KB
127 KB 273ms
158ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/0eb/800_10000_1/ui8ko1h1l2hqxnfjhronlt6gnxs73488.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: d8263d7d0275b2cc1ac1880dfa4b1b2aacc24ba527ddae5d050ee5e59d2e7465

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:35 GMT
server: nginx
etag: "65f19fef-1fa71"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 129649
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 gnxfegwnbn9x0flosynixqeyt10aea7y.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/89b/800_10000_1/ 123 KB
124 KB 273ms
158ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/89b/800_10000_1/gnxfegwnbn9x0flosynixqeyt10aea7y.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 32742760e4b812e7c531ea2b76d6fe62ef8bf8d5ddd5bf55e81e221756910b42

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:36 GMT
server: nginx
etag: "65f19ff0-1ed67"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 126311
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 1ccrjudj6hhw4n171otk4tofvs6wqqjo.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/4a1/800_10000_1/ 134 KB
135 KB 273ms
158ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/4a1/800_10000_1/1ccrjudj6hhw4n171otk4tofvs6wqqjo.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 978bd747f44350478cb7404fc988d3e8f32af3e65c0910014b50586606f878c3

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:36 GMT
server: nginx
etag: "65f19ff0-219ab"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 137643
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 9zyya0l4a0bjkjzm44duysqy9nsk54d4.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/ba2/800_10000_1/ 143 KB
144 KB 273ms
158ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/ba2/800_10000_1/9zyya0l4a0bjkjzm44duysqy9nsk54d4.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 74d1724c117e246ef69e8ba1e731c814adf0f845719032585a019464747f023e

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:37 GMT
server: nginx
etag: "65f19ff1-23d48"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 146760
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 0rpye7kvrksu3f4vle6w3zjcd6fxjft8.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/61d/800_10000_1/ 138 KB
139 KB 273ms
159ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/61d/800_10000_1/0rpye7kvrksu3f4vle6w3zjcd6fxjft8.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 33a52784afc100b9d4ef4e47f3d1792bbdb91d5d8f71f1a6d4b1791a6c893fea

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:37 GMT
server: nginx
etag: "65f19ff1-22921"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 141601
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 chf06he6vir6tzlftc4lkahdd8qg2kap.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/ade/800_10000_1/ 121 KB
121 KB 273ms
159ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/ade/800_10000_1/chf06he6vir6tzlftc4lkahdd8qg2kap.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: b735486ae37515b6ba01849a81c1725ddca0cf1bce79131006be9104da66ff6e

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:38 GMT
server: nginx
etag: "65f19ff2-1e45f"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 123999
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 rrwqnobbkq5t1dt227xo7kevm52guo7x.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/931/800_10000_1/ 97 KB
97 KB 273ms
159ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/931/800_10000_1/rrwqnobbkq5t1dt227xo7kevm52guo7x.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 440b8f6b23db8984971d5bbeb571aecf14ad32395b755dcd12fc07f7fa708050

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:38 GMT
server: nginx
etag: "65f19ff2-182b4"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 98996
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 8ob17n0kvl16207fpw8ao16mt3ygsceq.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/0b7/800_10000_1/ 55 KB
55 KB 273ms
159ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/0b7/800_10000_1/8ob17n0kvl16207fpw8ao16mt3ygsceq.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 7afad46f43f492f5bef9d3c7841e255fba6b17355a4f4ad83b7be5c2f97fe595

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:38 GMT
server: nginx
etag: "65f19ff2-db24"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 56100
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 8x3o14kknz58r7xgj2n8q4r0hpyaaj6u.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/ce3/800_10000_1/ 83 KB
83 KB 273ms
159ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/ce3/800_10000_1/8x3o14kknz58r7xgj2n8q4r0hpyaaj6u.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: c04cb249205e1c7ed91b9ada1700c3319501b7a876e773a44c52ef389d070f9a

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:39 GMT
server: nginx
etag: "65f19ff3-14b81"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 84865
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 nikije8ra4tk5tsqefib3qmcasklpumf.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/967/800_10000_1/ 83 KB
84 KB 273ms
160ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/967/800_10000_1/nikije8ra4tk5tsqefib3qmcasklpumf.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: bb1861ac650af8d03228af423b9fde0aced116ee4734519b881b188984f0f0f7

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:39 GMT
server: nginx
etag: "65f19ff3-14d4d"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 85325
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 1kl2fa2pdaeoph6relauenk12shjbje0.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/c0b/800_10000_1/ 115 KB
115 KB 272ms
160ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/c0b/800_10000_1/1kl2fa2pdaeoph6relauenk12shjbje0.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: d1130028a17bc39301e0b46c2d9176d4430ad49cb9332fbc894c17a71917317d

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:40 GMT
server: nginx
etag: "65f19ff4-1caee"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 117486
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 pu99mzqvmbo3bklz1vs1fkse6noj1wlm.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/0d7/800_10000_1/ 98 KB
98 KB 272ms
161ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/0d7/800_10000_1/pu99mzqvmbo3bklz1vs1fkse6noj1wlm.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 4910f4f7670e058c7852ce56a45028dc4939b7f5931408960c30ebc4d0646b9d

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:41 GMT
server: nginx
etag: "65f19ff5-18851"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 100433
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 veqfx2aw25uyqjiqqfd2kd963t8ljzbm.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/6da/800_10000_1/ 63 KB
64 KB 267ms
161ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/6da/800_10000_1/veqfx2aw25uyqjiqqfd2kd963t8ljzbm.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: f168ed9e7c5064902b122a4d4c1697fb336c1dfe110823a92652cfed49b3884e

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:41 GMT
server: nginx
etag: "65f19ff5-fdfd"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 65021
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 v1k75th00yw65focwhl1qfztal8ztoxi.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/2e8/800_10000_1/ 122 KB
122 KB 267ms
162ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/2e8/800_10000_1/v1k75th00yw65focwhl1qfztal8ztoxi.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 64a1b172e2a5b00215bdf80d4a9ba6c006b5caeee3d4b098f6288303571c4232

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:42 GMT
server: nginx
etag: "65f19ff6-1e808"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 124936
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 whgrm7x3yvntybt4wxl7nin64cj72tbq.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/a9c/800_10000_1/ 119 KB
119 KB 425ms
320ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/a9c/800_10000_1/whgrm7x3yvntybt4wxl7nin64cj72tbq.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 336f5a298721b735faa9ef24529df7767553a671d02093d100aa9356708ef3d5

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:43 GMT
server: nginx
etag: "65f19ff7-1dbe2"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 121826
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 p0zfoxpgkg8a0yf21nyq6xenxukfu5eg.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/007/800_10000_1/ 93 KB
93 KB 425ms
320ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/007/800_10000_1/p0zfoxpgkg8a0yf21nyq6xenxukfu5eg.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: a5c2329e04bc3b306276f194a4524a28f368a6559c058484f0549e764f0c1cc1

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:44 GMT
server: nginx
etag: "65f19ff8-1736a"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 95082
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 y45a3t82kiei3pr36rc0vwp8gj5ggiyk.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/0bb/800_10000_1/ 94 KB
95 KB 425ms
320ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/0bb/800_10000_1/y45a3t82kiei3pr36rc0vwp8gj5ggiyk.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 82c5b9363fbcdc6fa97dddedca1cd9697085d7ed7ff7543ae7d320f7f4a4de47

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:45 GMT
server: nginx
etag: "65f19ff9-1792c"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 96556
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 2bvd726wg2m9jd971x12ynvepub92na0.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/181/800_10000_1/ 67 KB
67 KB 425ms
321ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/181/800_10000_1/2bvd726wg2m9jd971x12ynvepub92na0.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: ce17ee65b6eae1e71246051c00b760659c2b33de10c6472372a867196321d808

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:46 GMT
server: nginx
etag: "65f19ffa-10c8a"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 68746
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 0gwk7hwatii2xrnzwzs8tx3klla269pc.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/e37/800_10000_1/ 60 KB
60 KB 424ms
321ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/e37/800_10000_1/0gwk7hwatii2xrnzwzs8tx3klla269pc.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: fa0a16328fb615dff4d75243466bf8d36535db1b6111d98276d33fc4c5e3b926

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:47 GMT
server: nginx
etag: "65f19ffb-ef61"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 61281
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 tu1ck05x0qh6p7mqllh7bhuadhd57zxc.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/d3d/800_10000_1/ 48 KB
49 KB 424ms
322ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/d3d/800_10000_1/tu1ck05x0qh6p7mqllh7bhuadhd57zxc.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: b6ec7bd05d9844d1d1001dbcf88d431322a4df591ef8240bbf22d2cdd711f745

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:49 GMT
server: nginx
etag: "65f19ffd-c1b3"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 49587
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 o9d21emddizpi5n5zd3hoo2b9kyzj8p9.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/d97/800_10000_1/ 61 KB
61 KB 424ms
322ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/d97/800_10000_1/o9d21emddizpi5n5zd3hoo2b9kyzj8p9.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 4e0902d25cdd2fa30a158a0ec715d36789d3282936b94c2b5997bd76e6035cd0

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:50 GMT
server: nginx
etag: "65f19ffe-f30a"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 62218
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 fg8sslsgm1f31bbeq7ileywk2g4k84ha.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/a1a/800_10000_1/ 122 KB
122 KB 424ms
322ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/a1a/800_10000_1/fg8sslsgm1f31bbeq7ileywk2g4k84ha.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 84da6a89aeb1d9f3510c49ffcaabb1e4f545bb970ec1ff2fe2eb47350084aecf

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:50 GMT
server: nginx
etag: "65f19ffe-1e6b0"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 124592
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 zadal683by0x3lnzq75kei8l9wqaxu20.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/306/800_10000_1/ 92 KB
92 KB 424ms
323ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/306/800_10000_1/zadal683by0x3lnzq75kei8l9wqaxu20.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 4360c3725ed04bc567a922dc144de337f517ae903273a249dba2abba6d88b021

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:51 GMT
server: nginx
etag: "65f19fff-16e86"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 93830
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 0jrb59yly3m4wh7ivejy838zx5puwnlf.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/095/800_10000_1/ 62 KB
62 KB 424ms
323ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/095/800_10000_1/0jrb59yly3m4wh7ivejy838zx5puwnlf.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: abc2a02dd3edeafe391961a4ee9e919b410bc7ab4f3a66fd4b9e25f3c0aa0a94

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:51 GMT
server: nginx
etag: "65f19fff-f6d2"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 63186
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 fg38blgmgig9s0hidws5skzimliunxi7.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/854/800_10000_1/ 107 KB
108 KB 423ms
323ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/854/800_10000_1/fg38blgmgig9s0hidws5skzimliunxi7.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: cddc1d34d99b031ff582ee0b7d9e6a0a5d83f21592d91a063910b724d0c2b420

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:52 GMT
server: nginx
etag: "65f1a000-1ad88"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 109960
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 w5624t6ivfm15o3sj9py75drg649jok6.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/0a7/800_10000_1/ 68 KB
68 KB 422ms
323ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/0a7/800_10000_1/w5624t6ivfm15o3sj9py75drg649jok6.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 04820a7f50271590e1066f449b64d80a5cef60580f7d9bdf291a1029b9685048

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:52 GMT
server: nginx
etag: "65f1a000-10e68"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 69224
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 8nl8ev5m6hyo7jjbm4b0s4w2i384enbn.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/621/800_10000_1/ 98 KB
99 KB 422ms
324ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/621/800_10000_1/8nl8ev5m6hyo7jjbm4b0s4w2i384enbn.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: e5b7c029b0bf55b78d9c66a97fc2587c3161a5be15fb3624844e9326c17fc79b

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:52 GMT
server: nginx
etag: "65f1a000-18900"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 100608
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 5z038vg9lzr0uwqxf5bc87rl24glfi6w.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/08c/800_10000_1/ 83 KB
83 KB 422ms
324ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/08c/800_10000_1/5z038vg9lzr0uwqxf5bc87rl24glfi6w.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 223f57f72bb33e802fc66b326a7100d8cef4da591f595b343906a246b07c6153

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:53 GMT
server: nginx
etag: "65f1a001-14a9a"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 84634
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 gaeedvrussnrkngymxlhjin5ee6kw8xw.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/cf9/800_10000_1/ 88 KB
88 KB 422ms
324ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/cf9/800_10000_1/gaeedvrussnrkngymxlhjin5ee6kw8xw.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 306f24411f6fb057c232014750d122afe35caf43190b32392d19ad679180afad

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:53 GMT
server: nginx
etag: "65f1a001-15e5a"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 89690
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 eu7bm82ykv0rmxm6ccuomjzjbx4i3nik.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/0d5/800_10000_1/ 117 KB
118 KB 422ms
324ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/0d5/800_10000_1/eu7bm82ykv0rmxm6ccuomjzjbx4i3nik.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 965651d572172019f1a0d1ba6f591b519f9e5bc08f897b37837a21b2df661d04

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:53 GMT
server: nginx
etag: "65f1a001-1d546"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 120134
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 8ubhvqpjqzvj3cvddgzb7uwkoibx47fq.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/719/800_10000_1/ 86 KB
86 KB 421ms
325ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/719/800_10000_1/8ubhvqpjqzvj3cvddgzb7uwkoibx47fq.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 4fd74d7808584363092b9b0e2668269f87e47511a8f222ea0e69332a759ae8d0

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:53 GMT
server: nginx
etag: "65f1a001-15670"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 87664
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 bss33otrrue6gbqmhq4zcpzjsauu1knt.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/604/800_10000_1/ 109 KB
109 KB 421ms
325ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/604/800_10000_1/bss33otrrue6gbqmhq4zcpzjsauu1knt.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: b1deef9203bf93f6d7f5e5662c41ef427affb2dcf278dd0bf1692a408b552814

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:54 GMT
server: nginx
etag: "65f1a002-1b39c"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 111516
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 fa68trtd9k93a9theo641ba117ztzvlm.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/5ce/800_10000_1/ 65 KB
65 KB 421ms
325ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/5ce/800_10000_1/fa68trtd9k93a9theo641ba117ztzvlm.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 84b3500a56da7d67f975577bee0f1f58ca10faa9f55119b56e2e2b6f1839403d

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:54 GMT
server: nginx
etag: "65f1a002-10305"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 66309
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 jpypd8auhymsx5ixbpbhq5q89hwfgf4q.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/399/800_10000_1/ 65 KB
65 KB 419ms
326ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/399/800_10000_1/jpypd8auhymsx5ixbpbhq5q89hwfgf4q.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: b023b38a8513cf8f1d86ba82a1c9d0bfa8e31263baf1e1f1f5689a01de624390

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:54 GMT
server: nginx
etag: "65f1a002-10360"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 66400
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 nd12l2mgnvplzq024a6zv88y5balw4r7.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/852/800_10000_1/ 76 KB
76 KB 419ms
326ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/852/800_10000_1/nd12l2mgnvplzq024a6zv88y5balw4r7.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: d68a7f81eecb6506a65ff22ac6d00601bd764716f2d917050111fe2a38cc2fb3

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:54 GMT
server: nginx
etag: "65f1a002-12fcc"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 77772
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 3ukhvh9c7whjptjyu03bc0b8o208tlei.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/7f5/800_10000_1/ 72 KB
72 KB 420ms
326ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/7f5/800_10000_1/3ukhvh9c7whjptjyu03bc0b8o208tlei.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: de940c620cc23f6224272e6752bcc29eb85e001caf8f0361aae5c08b886a4231

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:55 GMT
server: nginx
etag: "65f1a003-11f4d"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 73549
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 jrh29mmpcrb4a023qdgmty7ylsqezt1a.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/742/800_10000_1/ 109 KB
110 KB 420ms
326ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/742/800_10000_1/jrh29mmpcrb4a023qdgmty7ylsqezt1a.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: fb20a8e9132015afeb20c3176f0093a03f5a5f30860ff289acc7babe5edc87be

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:55 GMT
server: nginx
etag: "65f1a003-1b59e"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 112030
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 dfbdwqilgxxkd00pk25h417vk35y0ccb.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/4b6/800_10000_1/ 75 KB
75 KB 420ms
327ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/4b6/800_10000_1/dfbdwqilgxxkd00pk25h417vk35y0ccb.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 59a67785c8767b2239b2fac0f6087f4f7cb3714b2e4203453f686ce5c736fa47

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:55 GMT
server: nginx
etag: "65f1a003-12bf8"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 76792
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 8zlwra04ahybubhp06k3m7gntyh00p4r.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/5d1/800_10000_1/ 55 KB
55 KB 420ms
327ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/5d1/800_10000_1/8zlwra04ahybubhp06k3m7gntyh00p4r.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: bd49fd79768e2d723d3cda7746b7e21285728503b1d990b86e0e7173dc5c5829

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:56 GMT
server: nginx
etag: "65f1a004-daf1"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 56049
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 9s262wqfxu22hal2qqgf87s57dpxqi7g.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/147/800_10000_1/ 55 KB
55 KB 420ms
327ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/147/800_10000_1/9s262wqfxu22hal2qqgf87s57dpxqi7g.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 83baf8b049d65098236ab9abd8161634c8e9327ff4840fadacbe5f116689a408

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:56 GMT
server: nginx
etag: "65f1a004-dcf5"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 56565
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 in3l7esi37zza4tvwug764ds0hr0lk9u.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/722/800_10000_1/ 110 KB
111 KB 420ms
327ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/722/800_10000_1/in3l7esi37zza4tvwug764ds0hr0lk9u.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 8e5486050716939cd6b2cf6ce49742148fe3b48d63d0f817a1c7d69c6a6909ae

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:56 GMT
server: nginx
etag: "65f1a004-1b9f4"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 113140
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 d28vzz0dxo37zhyxbjt47v8ao2mxztyf.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/3ff/800_10000_1/ 111 KB
111 KB 420ms
328ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/3ff/800_10000_1/d28vzz0dxo37zhyxbjt47v8ao2mxztyf.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 7af6f8ce9c1d2d549b23442cdd0bfca83c68afff232fdfae2185f942e4160dee

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:56 GMT
server: nginx
etag: "65f1a004-1bb73"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 113523
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 l6jsitdmwnzbof13r0wj11af3iet37w8.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/e6a/800_10000_1/ 64 KB
64 KB 420ms
328ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/e6a/800_10000_1/l6jsitdmwnzbof13r0wj11af3iet37w8.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 51740b2f965691265d745ad88000d13f35e9dde2c979fc14227fa5c2143fcb49

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:57 GMT
server: nginx
etag: "65f1a005-fe8c"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 65164
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 d35hw0v4m9s2em5k6rs90jyg2n0hy8e9.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/feb/800_10000_1/ 129 KB
129 KB 420ms
328ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/feb/800_10000_1/d35hw0v4m9s2em5k6rs90jyg2n0hy8e9.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: ab7cdce5cd5091e7b60f91d621da3b25a1335229b69e5e0caf4408042aec31a2

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:57 GMT
server: nginx
etag: "65f1a005-2041f"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 132127
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 23zhqba99vscd5ndx84a58oz63g0iymz.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/22e/800_10000_1/ 115 KB
115 KB 420ms
329ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/22e/800_10000_1/23zhqba99vscd5ndx84a58oz63g0iymz.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 1c6707750fc8f9e2b20ac54a56e850d100cea0eea935e2de7b324661ab09390b

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:57 GMT
server: nginx
etag: "65f1a005-1cb20"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 117536
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 ui6sfc6yz1tg539tq441baq2lylvlqnr.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/6ca/800_10000_1/ 115 KB
115 KB 420ms
329ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/6ca/800_10000_1/ui6sfc6yz1tg539tq441baq2lylvlqnr.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: a2bb952d1c91af6a7519b93bb6966a6cd50e6cf440b7ff21ed99dd926dc55550

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:58 GMT
server: nginx
etag: "65f1a006-1cba8"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 117672
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 bf4b1wfx55blwc79vsz1000izoe2lpyj.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/a13/800_10000_1/ 121 KB
122 KB 420ms
329ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/a13/800_10000_1/bf4b1wfx55blwc79vsz1000izoe2lpyj.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: d6f14b5619f1535a2261335a3385477d9db11d301d6af54443d86a4dbb9b9745

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:58 GMT
server: nginx
etag: "65f1a006-1e56b"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 124267
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 8r111f3l05qqrog1mnzukpf9u772mfdu.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/c35/800_10000_1/ 147 KB
147 KB 420ms
329ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/c35/800_10000_1/8r111f3l05qqrog1mnzukpf9u772mfdu.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: c68a77505ed905ff6eafd879dea3e63fdf43b1033f0055d84057bfc57de20e98

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:59 GMT
server: nginx
etag: "65f1a007-24b55"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 150357
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 9pktcz1jqfojjlhxh67013nmi8obm40d.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/d72/800_10000_1/ 104 KB
105 KB 420ms
329ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/d72/800_10000_1/9pktcz1jqfojjlhxh67013nmi8obm40d.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 2c5997b3a93101f814d3926dd767dab1dd2ed6433775975c7f80a4a7e14044cf

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:59 GMT
server: nginx
etag: "65f1a007-1a124"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 106788
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 ietydc0jwqu9qs9wicteu09nua5zf776.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/b94/800_10000_1/ 88 KB
88 KB 420ms
330ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/b94/800_10000_1/ietydc0jwqu9qs9wicteu09nua5zf776.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 7ab308f4548f873935923e12b63f10fef7b1cdff82a78ea68e65088de26eabc8

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:45:59 GMT
server: nginx
etag: "65f1a007-15f22"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 89890
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 7orlgrdd6kwock24smw4n0gji1l3o436.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/b88/800_10000_1/ 92 KB
92 KB 419ms
330ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/b88/800_10000_1/7orlgrdd6kwock24smw4n0gji1l3o436.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: f93a11a6acdac35b0d29eb5989255601f36708a3a8cab98215a0b76fcc02612b

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:46:00 GMT
server: nginx
etag: "65f1a008-170d3"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 94419
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 0w9b6xyg5jmw882i910hym9jykewmhy0.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/89b/800_10000_1/ 128 KB
128 KB 419ms
330ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/89b/800_10000_1/0w9b6xyg5jmw882i910hym9jykewmhy0.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 6af8c3cd2e097fc664f9d23ab6e02888d686b69f51b37f3cee626de808fa5eb5

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:46:00 GMT
server: nginx
etag: "65f1a008-2009b"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 131227
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 0jirsfx2q9c0kvr4fy8obs9dh0fb0yc7.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/e8f/800_10000_1/ 78 KB
78 KB 419ms
330ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/e8f/800_10000_1/0jirsfx2q9c0kvr4fy8obs9dh0fb0yc7.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: f312f6fe158efa56734374769ab57012dab12ed9e81f8fa627d6fbca897191f2

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:46:01 GMT
server: nginx
etag: "65f1a009-13637"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 79415
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 dae19stgwltaioetlxl86pxi5net3sr6.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/498/800_10000_1/ 114 KB
114 KB 419ms
330ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/498/800_10000_1/dae19stgwltaioetlxl86pxi5net3sr6.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: fd82a8bc7f7c133ad62957a94837307063cba8818f278a8059d06d463d731f38

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:46:01 GMT
server: nginx
etag: "65f1a009-1c628"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 116264
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 v5h63gkmx8neo0vj8trdebjc3gqh4pq0.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/59c/800_10000_1/ 126 KB
127 KB 419ms
331ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/59c/800_10000_1/v5h63gkmx8neo0vj8trdebjc3gqh4pq0.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 17ccf93df899ac34c6994060c361e28a7d1ed28a12c7d3006358844ec15ee748

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:46:02 GMT
server: nginx
etag: "65f1a00a-1f95e"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 129374
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 45fs5dds5jie3wgmy09zsa9shcymu04o.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/ae7/800_10000_1/ 108 KB
108 KB 419ms
331ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/ae7/800_10000_1/45fs5dds5jie3wgmy09zsa9shcymu04o.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 22ab1479cfba1de431f64cc1d1cde62965c4f3aba72bdca1b695dce37ea8bcf0

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:46:03 GMT
server: nginx
etag: "65f1a00b-1ae21"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 110113
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 b0sbw4ew9tzdo24jcr8l69eqxnio85zf.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/7ac/800_10000_1/ 95 KB
95 KB 419ms
331ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/7ac/800_10000_1/b0sbw4ew9tzdo24jcr8l69eqxnio85zf.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: b453799d6c5c5e40f1471b83613e502b5f03d0973d3e6bd1da8796d1c6aed049

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:46:04 GMT
server: nginx
etag: "65f1a00c-17b00"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 97024
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 302uwc198zh2tbfx07t8pr1e98zqghfa.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/c26/800_10000_1/ 121 KB
121 KB 419ms
331ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/c26/800_10000_1/302uwc198zh2tbfx07t8pr1e98zqghfa.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 35e707ef75557161d9c8007889664a50e7375123dd40d7cf324a81d8cb2049f5

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:46:04 GMT
server: nginx
etag: "65f1a00c-1e46b"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 124011
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 9gtjczig265tttpszcuuen5fse1ztktm.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/763/800_10000_1/ 134 KB
134 KB 419ms
331ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/763/800_10000_1/9gtjczig265tttpszcuuen5fse1ztktm.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: da87bc3a48dcf368b1b9d85c8173dd2f11cba5f3bdb9646364e627af5cf45fa6

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:46:05 GMT
server: nginx
etag: "65f1a00d-21872"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 137330
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 b8362z16jhzajiq5p8bwqikhfbsqtshj.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/74b/800_10000_1/ 104 KB
104 KB 426ms
339ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/74b/800_10000_1/b8362z16jhzajiq5p8bwqikhfbsqtshj.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 9973f5bfc7491f2776d31ad7e5c5b2b34a4137c4ab6aba983838476cec0e4dbe

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:46:05 GMT
server: nginx
etag: "65f1a00d-19f9b"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 106395
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 sq87cqj0wyxf4rigap3bvapf05dzhtnf.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/c17/800_10000_1/ 105 KB
105 KB 426ms
340ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/c17/800_10000_1/sq87cqj0wyxf4rigap3bvapf05dzhtnf.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: f7f84985eb79f17de0f8c2292fa0b095c3cfadb9e89519f34d239d60594a1f8a

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:46:06 GMT
server: nginx
etag: "65f1a00e-1a225"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 107045
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 5ane630fog8o2fsr5r0rvwbteyq03bs3.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/6ae/800_10000_1/ 92 KB
92 KB 426ms
340ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/6ae/800_10000_1/5ane630fog8o2fsr5r0rvwbteyq03bs3.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: e5f7da1d4c7bbbd3660585cf8342b671059d2fd6662361ae2e25d6aad613ac53

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:46:06 GMT
server: nginx
etag: "65f1a00e-16fca"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 94154
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 bec59mvgg98z7c2gj24e0stasakc01ee.JPG
13.testfamilygarden.su/upload/resize_cache/iblock/2d6/800_10000_1/ 128 KB
129 KB 426ms
340ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/2d6/800_10000_1/bec59mvgg98z7c2gj24e0stasakc01ee.JPG
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: bce4059881819b924d7220acf1ec05791131c514dfc03b22b171c0fb00215ca5

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:46:07 GMT
server: nginx
etag: "65f1a00f-201fe"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 131582
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 fw2gh0zbgw2wzzrrl2qalnw1tc1pdb6g.JPG
13.testfamilygarden.su/upload/resize_cache/iblock/694/800_10000_1/ 115 KB
116 KB 426ms
341ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/694/800_10000_1/fw2gh0zbgw2wzzrrl2qalnw1tc1pdb6g.JPG
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: ddf8020cf453978d99568f65166dbece6fa9ea9cf791cd68e12c14e577908692

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:46:07 GMT
server: nginx
etag: "65f1a00f-1cdf1"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 118257
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 oimj5vw6xj9jm4m98z63pzazgmi2t4h1.JPG
13.testfamilygarden.su/upload/resize_cache/iblock/11b/800_10000_1/ 89 KB
89 KB 426ms
341ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/11b/800_10000_1/oimj5vw6xj9jm4m98z63pzazgmi2t4h1.JPG
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: c01bebf2da9370e8288899822389a31c7a427abdf664145824dde7bf03ff22f3

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:46:07 GMT
server: nginx
etag: "65f1a00f-16298"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 90776
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 fkquwv817xjotk8r85bpmus2hfgm2mxa.JPG
13.testfamilygarden.su/upload/resize_cache/iblock/883/800_10000_1/ 120 KB
121 KB 425ms
341ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/883/800_10000_1/fkquwv817xjotk8r85bpmus2hfgm2mxa.JPG
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 298dff5d20ebe5e7890b0e6cacab319f4849ef97c6ba70feacd1fd2c35a5fbb1

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:46:08 GMT
server: nginx
etag: "65f1a010-1e156"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 123222
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 gzn4g68wa2srdx1ng22khnm13c1h34rt.JPG
13.testfamilygarden.su/upload/resize_cache/iblock/9ad/800_10000_1/ 109 KB
109 KB 425ms
342ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/9ad/800_10000_1/gzn4g68wa2srdx1ng22khnm13c1h34rt.JPG
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 5c9089c2a4075d0b6b2f1f9fca56b3edce7fdc920123bbfa1ba2b5083bf58fc4

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:46:08 GMT
server: nginx
etag: "65f1a010-1b474"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 111732
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 8tqm3dxa1ghlxb906ged3ahmpj9bo2g1.JPG
13.testfamilygarden.su/upload/resize_cache/iblock/55f/800_10000_1/ 115 KB
115 KB 425ms
342ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/55f/800_10000_1/8tqm3dxa1ghlxb906ged3ahmpj9bo2g1.JPG
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 9b86e97e9daf56973888aee6caffd2c6b82bfcb111c9ec2f9ded50a7777668e0

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:46:08 GMT
server: nginx
etag: "65f1a010-1cc51"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 117841
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 51dcix2ed0c62a65zgzxogd76dxz76zn.JPG
13.testfamilygarden.su/upload/resize_cache/iblock/6cb/800_10000_1/ 130 KB
130 KB 425ms
342ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/6cb/800_10000_1/51dcix2ed0c62a65zgzxogd76dxz76zn.JPG
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 85e251ebd914bedddf4262fce695d37527c942b0dcd8aa09e7d414f1a21b57cc

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:46:09 GMT
server: nginx
etag: "65f1a011-2077e"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 132990
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 dsi6pqjtr2fn74i282w6gnxjvaumfrzq.JPG
13.testfamilygarden.su/upload/resize_cache/iblock/923/800_10000_1/ 89 KB
89 KB 425ms
342ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/923/800_10000_1/dsi6pqjtr2fn74i282w6gnxjvaumfrzq.JPG
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: c9af66753862fa0c5dfa45edf7586e88e5e0143c3b59782c7d66e13f68f06684

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:46:09 GMT
server: nginx
etag: "65f1a011-16439"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 91193
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 892r4zg9quz8bgu2gvoj1ouhmnacvgff.JPG
13.testfamilygarden.su/upload/resize_cache/iblock/2ba/800_10000_1/ 108 KB
109 KB 425ms
343ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/2ba/800_10000_1/892r4zg9quz8bgu2gvoj1ouhmnacvgff.JPG
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 73c97186fbb2f424fff0743cbf78c819edad9a1373e84e9c1ea4a60c10a3c117

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:46:09 GMT
server: nginx
etag: "65f1a011-1b12e"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 110894
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 dqem8t504rc7doewpl3k196yls5w228v.JPG
13.testfamilygarden.su/upload/resize_cache/iblock/7b4/800_10000_1/ 120 KB
120 KB 425ms
343ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/7b4/800_10000_1/dqem8t504rc7doewpl3k196yls5w228v.JPG
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: d76673426b53cca9f31f7b677597239ea8fe3e85c58ecbbceb05793a02d2385e

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:46:10 GMT
server: nginx
etag: "65f1a012-1df07"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 122631
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 wicft3ogtnff1lnob11qm54rb17oiqrh.JPG
13.testfamilygarden.su/upload/resize_cache/iblock/3c8/800_10000_1/ 144 KB
145 KB 426ms
344ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/3c8/800_10000_1/wicft3ogtnff1lnob11qm54rb17oiqrh.JPG
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: a1688cc54e006f9a2a5db4060956949c996786cf5f35e1e4e5ac7d0bcd9a9b18

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:46:10 GMT
server: nginx
etag: "65f1a012-240f3"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 147699
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 gnc7u16rikf4jh4b8wbbw3afsxi1y256.JPG
13.testfamilygarden.su/upload/resize_cache/iblock/742/800_10000_1/ 102 KB
102 KB 426ms
344ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/742/800_10000_1/gnc7u16rikf4jh4b8wbbw3afsxi1y256.JPG
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: a2b7ba32dbb0137b65eed0e687c1662de1b416619bc4c9e99f8a9003eaca4f7e

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:46:10 GMT
server: nginx
etag: "65f1a012-196b5"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 104117
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 93df88jol6fz7thydymaiyjssfsqs6nq.JPG
13.testfamilygarden.su/upload/resize_cache/iblock/5ec/800_10000_1/ 117 KB
117 KB 426ms
344ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/5ec/800_10000_1/93df88jol6fz7thydymaiyjssfsqs6nq.JPG
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: efd355a4a74778d21619b5ebec26d06b0657898e03c1c7988678c5afed5dd812

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:46:11 GMT
server: nginx
etag: "65f1a013-1d355"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 119637
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 iz05toazing97g2lr1jagxmf8536mln5.JPG
13.testfamilygarden.su/upload/resize_cache/iblock/541/800_10000_1/ 84 KB
84 KB 426ms
345ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/541/800_10000_1/iz05toazing97g2lr1jagxmf8536mln5.JPG
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 2b43ab6c520b59d35d3fe36ac88dc61cea3c35922a8cd319392c61d4c0a0a956

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:46:11 GMT
server: nginx
etag: "65f1a013-14f24"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 85796
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 3w7l8xjvzvswydypmyv3qyty0c8segve.JPG
13.testfamilygarden.su/upload/resize_cache/iblock/559/800_10000_1/ 118 KB
118 KB 426ms
345ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/559/800_10000_1/3w7l8xjvzvswydypmyv3qyty0c8segve.JPG
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: fa48ab049e70b5a3f325f5bd1852fe5c696feedc2c292ff30359550487a5f3ba

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:46:11 GMT
server: nginx
etag: "65f1a013-1d807"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 120839
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 h8w8ixg9u73akqtss9r3maekvn42058j.JPG
13.testfamilygarden.su/upload/resize_cache/iblock/ffc/800_10000_1/ 107 KB
107 KB 426ms
345ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/ffc/800_10000_1/h8w8ixg9u73akqtss9r3maekvn42058j.JPG
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: a4d0c3a8db46379d644607e385e4b513b652557e2f64c4a457b6d637b90e5c5b

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:46:11 GMT
server: nginx
etag: "65f1a013-1aab9"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 109241
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 ybkgh6eeav2othdkugkyuqp5xssgli55.JPG
13.testfamilygarden.su/upload/resize_cache/iblock/e35/800_10000_1/ 110 KB
110 KB 426ms
346ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/e35/800_10000_1/ybkgh6eeav2othdkugkyuqp5xssgli55.JPG
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: f150a093d12b653438da937c8bb7a9826e2681bc816156fea8b07ac77f1bcc3c

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:46:12 GMT
server: nginx
etag: "65f1a014-1b8ca"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 112842
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 xck2qda2s5cgdbemjc3xedyavk4owc16.JPG
13.testfamilygarden.su/upload/resize_cache/iblock/88c/800_10000_1/ 101 KB
102 KB 426ms
346ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/88c/800_10000_1/xck2qda2s5cgdbemjc3xedyavk4owc16.JPG
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: ee8e5262205bc89ab69f4d27ba8b9486a899e0c3059d36135faf8d07753b7e51

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:46:12 GMT
server: nginx
etag: "65f1a014-1958a"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 103818
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 xttaw9xfy87exup0z2lurnsz0e60cq3a.JPG
13.testfamilygarden.su/upload/resize_cache/iblock/6c1/800_10000_1/ 102 KB
102 KB 426ms
346ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/6c1/800_10000_1/xttaw9xfy87exup0z2lurnsz0e60cq3a.JPG
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 69010b4bf5e31d8feb8557c30e393c498fd880d1b020ecd30dad85f25b1bb5fb

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:46:12 GMT
server: nginx
etag: "65f1a014-19755"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 104277
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 8k9is4bq33p7nkoisthwpr9r21dj78j2.JPG
13.testfamilygarden.su/upload/resize_cache/iblock/eff/800_10000_1/ 119 KB
120 KB 426ms
347ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/eff/800_10000_1/8k9is4bq33p7nkoisthwpr9r21dj78j2.JPG
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 82b57b3950c6d43cffc1ae9c368581da06f54d161520de0d8c192f0e91407603

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:46:13 GMT
server: nginx
etag: "65f1a015-1ddcd"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 122317
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 3mjhwcg67d832843x87ihpgqjoo7yy4c.JPG
13.testfamilygarden.su/upload/resize_cache/iblock/40f/800_10000_1/ 133 KB
133 KB 426ms
347ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/40f/800_10000_1/3mjhwcg67d832843x87ihpgqjoo7yy4c.JPG
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 090f40514478914d482828e00678d0f011a49730c079ce2ab77b4b83771d1c9c

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:46:13 GMT
server: nginx
etag: "65f1a015-2141e"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 136222
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 bo922wtad9oqtxyzb3qn08evtjrhoezk.JPG
13.testfamilygarden.su/upload/resize_cache/iblock/ac8/800_10000_1/ 131 KB
131 KB 427ms
347ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/ac8/800_10000_1/bo922wtad9oqtxyzb3qn08evtjrhoezk.JPG
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 0cb7353187dc0db57aae7a75e7ccf836f06c5d8c700d8d87694b6b4837ea63e6

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:46:13 GMT
server: nginx
etag: "65f1a015-20a96"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 133782
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 ttf3h2n25za55qgl8w4e77rk5ibnrwa7.JPG
13.testfamilygarden.su/upload/resize_cache/iblock/cb2/800_10000_1/ 172 KB
172 KB 427ms
347ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/cb2/800_10000_1/ttf3h2n25za55qgl8w4e77rk5ibnrwa7.JPG
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 560bbd94cdf8011144efea0808a91b1465ef6223bf7335246b6558463ad23528

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:46:14 GMT
server: nginx
etag: "65f1a016-2ae8d"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 175757
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 reserved.jpg
13.testfamilygarden.su/local/templates/injir_dev/img/ 29 KB
29 KB 426ms
348ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/local/templates/injir_dev/img/reserved.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: bf343826c69ad859bf5075280d90551bec1bd20de14779b79b093014a328c30f

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:35:48 GMT
server: nginx
etag: "65f19da4-743d"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 29757
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 fhnq5l8pglrskz574u3sxczv0yt19s1w.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/295/320_10000_1/ 26 KB
26 KB 426ms
348ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/295/320_10000_1/fhnq5l8pglrskz574u3sxczv0yt19s1w.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: ef416e765e2598580a76d50d672a3cabd5fb956bcc3ccc7d799f9cd9143d8cfe

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 13:37:58 GMT
server: nginx
etag: "65f1ac36-672e"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 26414
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 oo5k7tbh1c9z4at2dwij5wjszqw2vuv2.jpeg
13.testfamilygarden.su/upload/resize_cache/iblock/377/320_10000_1/ 30 KB
30 KB 426ms
348ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/377/320_10000_1/oo5k7tbh1c9z4at2dwij5wjszqw2vuv2.jpeg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: e23cf2c5bac07a377f4a661fd5892d98ac7f40983630d52e6fbf8fde0456805a

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:56:45 GMT
server: nginx
etag: "65f1a28d-76b8"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 30392
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 xs9tmvj1koz6gv3qxvr5af90h3aei9pm.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/668/320_10000_1/ 20 KB
21 KB 427ms
349ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/668/320_10000_1/xs9tmvj1koz6gv3qxvr5af90h3aei9pm.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: ed69b1a3c1a91b533ea98479b82ae858342d0a96555bfeba5763cefa73001bb0

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 13:56:26 GMT
server: nginx
etag: "65f1b08a-5171"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 20849
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 n8c1ov383fgxz69h9psdc63fba894ra2.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/af1/320_10000_1/ 26 KB
27 KB 426ms
349ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/af1/320_10000_1/n8c1ov383fgxz69h9psdc63fba894ra2.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 4e142bb69daa98530941895752ed378406e07e254dc81cfc3645eca10004e5a3

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 13:56:26 GMT
server: nginx
etag: "65f1b08a-6937"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 26935
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 2jd60o0tgrq9tg8wdb3c43ol35jw6dsw.JPG
13.testfamilygarden.su/upload/resize_cache/iblock/8bb/320_10000_1/ 25 KB
25 KB 426ms
349ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/8bb/320_10000_1/2jd60o0tgrq9tg8wdb3c43ol35jw6dsw.JPG
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 7957b3d7cde0278dc5d1cf9013a9c38967572dd362e52af6d1e8770af6435be3

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 13:56:26 GMT
server: nginx
etag: "65f1b08a-63ba"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 25530
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 gh1r1v6btrbol8f4cd3idadf0p2sfkp7.JPG
13.testfamilygarden.su/upload/resize_cache/iblock/39e/320_10000_1/ 32 KB
33 KB 426ms
349ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/39e/320_10000_1/gh1r1v6btrbol8f4cd3idadf0p2sfkp7.JPG
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: dd91c38c9d4c690dc89ed6e86f8ca46f66914ffe7d6a5071b735f13b07d49e29

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 13:56:26 GMT
server: nginx
etag: "65f1b08a-8161"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 33121
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 3g552mhjzqjycexer4awqhkrlbzbpgs2.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/2c1/320_10000_1/ 30 KB
30 KB 426ms
350ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/2c1/320_10000_1/3g552mhjzqjycexer4awqhkrlbzbpgs2.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 076b106e4fc52df63663083b6af2177c62e6a61b676ed8f68c5a614ef17338df

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 13:56:27 GMT
server: nginx
etag: "65f1b08b-77f9"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 30713
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 fmdn9vvwrtjh8idqryjfzvs1er84bm86.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/af1/320_10000_1/ 19 KB
19 KB 426ms
350ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/af1/320_10000_1/fmdn9vvwrtjh8idqryjfzvs1er84bm86.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 887e09e3616f2d1f2bf37b28d4990c037a091430ece2e73796cba43742fa2b14

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 13:56:27 GMT
server: nginx
etag: "65f1b08b-4a40"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 19008
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 dwz7j3j3uea7jayg0056ovxy9cpax7rw.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/92d/320_10000_1/ 15 KB
15 KB 426ms
350ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/92d/320_10000_1/dwz7j3j3uea7jayg0056ovxy9cpax7rw.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 3da962311f19491248a0dcd9128d91820c46874d77514383fb49ca5958ac8a95

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 13:56:27 GMT
server: nginx
etag: "65f1b08b-3acb"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 15051
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 b133gsmh8x3s1ulix20p42qdyhvtly31.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/92c/320_10000_1/ 28 KB
28 KB 426ms
351ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/92c/320_10000_1/b133gsmh8x3s1ulix20p42qdyhvtly31.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 060b8316a48a927c08ba4f7bd397f0206c668d8868a59de0f742c907a6de2be5

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 13:56:27 GMT
server: nginx
etag: "65f1b08b-6e62"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 28258
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 x33q1yp580j6fse45w4zr9mxgen6nqtx.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/3e6/320_10000_1/ 28 KB
28 KB 426ms
351ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/3e6/320_10000_1/x33q1yp580j6fse45w4zr9mxgen6nqtx.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 515dfa6ae44eae1e79eea3414e838f70c3bcf76e67c1bbe57203caab418302d5

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 13:56:27 GMT
server: nginx
etag: "65f1b08b-6eea"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 28394
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 f9nicjm2ejndej0nqsm23c7c3ep0eh6m.JPG
13.testfamilygarden.su/upload/resize_cache/iblock/0c6/320_10000_1/ 23 KB
23 KB 426ms
351ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/0c6/320_10000_1/f9nicjm2ejndej0nqsm23c7c3ep0eh6m.JPG
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: bc029e99bc2542fc7750f5765a7b59614309b00799abdbeceb22e2bcfbc88397

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 13:56:27 GMT
server: nginx
etag: "65f1b08b-5c00"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 23552
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 v6zhpc9oyma4rc21d35yti7mr7oaira8.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/977/320_10000_1/ 27 KB
27 KB 426ms
351ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/977/320_10000_1/v6zhpc9oyma4rc21d35yti7mr7oaira8.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: f0dce0acd3aafb8948c228c8036ef5c799729195bba5f9e9f1b3dbba560089b2

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 13:56:27 GMT
server: nginx
etag: "65f1b08b-6ab0"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 27312
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 fg2o0i3dmvl9sz6g4cs9g4chqxm60zp0.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/f3d/320_10000_1/ 35 KB
35 KB 426ms
352ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/f3d/320_10000_1/fg2o0i3dmvl9sz6g4cs9g4chqxm60zp0.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 4da167c6be67515b71879fb5576908ad9422cf6f61bcfe54e412ca7c36050d10

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 13:56:27 GMT
server: nginx
etag: "65f1b08b-8cfd"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 36093
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 w86kyt5cmxr94x7w46zy439em2tqgj0p.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/eaf/320_10000_1/ 23 KB
23 KB 426ms
352ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/eaf/320_10000_1/w86kyt5cmxr94x7w46zy439em2tqgj0p.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 2df685b0e54c65fb5e32c81ec4f6f550defa5803718127db5bd01a99a05f1adf

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 13:56:27 GMT
server: nginx
etag: "65f1b08b-5be9"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 23529
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 1uiwqoov73rb2m9zd5m9d66zc4n2cqyw.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/340/320_10000_1/ 26 KB
26 KB 426ms
352ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/340/320_10000_1/1uiwqoov73rb2m9zd5m9d66zc4n2cqyw.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 13f48274ed06ca44d5882daadbd683ee3c1d83d24ef1ac39eb6671c408bb027d

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 13:56:27 GMT
server: nginx
etag: "65f1b08b-6671"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 26225
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 arbubvzov12abnvfxw7is6tt1mxkhg51.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/7e9/320_10000_1/ 36 KB
36 KB 426ms
353ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/7e9/320_10000_1/arbubvzov12abnvfxw7is6tt1mxkhg51.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 2ba0565ef9d982b3231058fdf49551ad61cda8830b054505618d1216126f6142

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 13:56:27 GMT
server: nginx
etag: "65f1b08b-8ed3"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 36563
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 2dun6d0ttsaipyr29xbo7mmdhbhscm9d.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/813/320_10000_1/ 29 KB
29 KB 426ms
353ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/813/320_10000_1/2dun6d0ttsaipyr29xbo7mmdhbhscm9d.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 1ada416747b3fe5e1913dd5b02dc0a09c2d18c19fa631306b4baf274d59a439c

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 13:56:28 GMT
server: nginx
etag: "65f1b08c-7309"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 29449
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 516622b2jgyv7rnl000wtphxm0rfwspo.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/01b/320_10000_1/ 29 KB
30 KB 426ms
353ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/01b/320_10000_1/516622b2jgyv7rnl000wtphxm0rfwspo.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 3cc216e8dcf433a8d7f2ff75f27914da9fa2e8536b372f8b506144147dfe86c4

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:56:45 GMT
server: nginx
etag: "65f1a28d-7565"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 30053
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 btqua5egmijgvnw8c701m99lnnp2j0c7.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/d5f/320_10000_1/ 27 KB
28 KB 426ms
188ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/d5f/320_10000_1/btqua5egmijgvnw8c701m99lnnp2j0c7.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: bccba0cf34252dd00de69ea640331f23c12b41c80b4026e17aebf8b9cbbad2d4

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:56:45 GMT
server: nginx
etag: "65f1a28d-6dc0"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 28096
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 alykjbpl23qzfi1llpd83rzcs3xw6u78.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/c39/320_10000_1/ 47 KB
48 KB 426ms
183ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/c39/320_10000_1/alykjbpl23qzfi1llpd83rzcs3xw6u78.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: a958d068ca75af240aeeb006bf0fb84219601c17232547dc4afa9811e1c5ece2

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:56:45 GMT
server: nginx
etag: "65f1a28d-bd37"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 48439
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 f35fu7maq2mu8u6nefhd0l1c087i0par.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/32b/320_10000_1/ 29 KB
30 KB 426ms
183ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/32b/320_10000_1/f35fu7maq2mu8u6nefhd0l1c087i0par.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: c3b1531a71fe32d9db65794b7f8b582b243130ffa74d40372930c2dd9977bf19

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:56:45 GMT
server: nginx
etag: "65f1a28d-75f0"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 30192
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 affwpgeyo93fjmbja12tbecdh6sxqu0t.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/92d/320_10000_1/ 30 KB
31 KB 1907ms
775ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/92d/320_10000_1/affwpgeyo93fjmbja12tbecdh6sxqu0t.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 57ccdbbc1a3838c71a25faac4d615e96997889cee219477a69d827b1e8b6d8e3

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:48 GMT
last-modified: Wed, 13 Mar 2024 12:56:45 GMT
server: nginx
etag: "65f1a28d-7985"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 31109
expires: Mon, 20 May 2024 12:41:48 GMT

GET
H2 200 j4yewnk1m39km3e0rh4v0yfd2q5xhezr.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/2c1/320_10000_1/ 28 KB
28 KB 426ms
184ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/2c1/320_10000_1/j4yewnk1m39km3e0rh4v0yfd2q5xhezr.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: df0bc6e3d2b4c76bbcf716f79734b5558eeb42bf84ec30b9a5cd526d1e08bd18

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:56:45 GMT
server: nginx
etag: "65f1a28d-704d"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 28749
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 prdxavu4zftt63l2z2su5p5dunoa8k6e.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/cb7/320_10000_1/ 29 KB
29 KB 2285ms
830ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/cb7/320_10000_1/prdxavu4zftt63l2z2su5p5dunoa8k6e.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 89144f304bc6fbc4131cb89b91c50bc8fa962565073e1b359c622eae966b3ff0

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:48 GMT
last-modified: Wed, 13 Mar 2024 12:56:45 GMT
server: nginx
etag: "65f1a28d-745a"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 29786
expires: Mon, 20 May 2024 12:41:48 GMT

GET
H2 200 l0n533jh8jisu9g1d6l9yb3q5qc9nfkr.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/1b4/320_10000_1/ 19 KB
19 KB 2285ms
829ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/1b4/320_10000_1/l0n533jh8jisu9g1d6l9yb3q5qc9nfkr.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 7dfb9f0b18ec63c4a097f9d61e0c568b4338270adfe6145b1ab7d94eeabba54b

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:48 GMT
last-modified: Wed, 13 Mar 2024 13:56:28 GMT
server: nginx
etag: "65f1b08c-4cf7"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 19703
expires: Mon, 20 May 2024 12:41:48 GMT

GET
H2 200 tif7uvi9j8ud5yvutinr1mm79s5su6ih.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/ce4/320_10000_1/ 31 KB
31 KB 2285ms
828ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/ce4/320_10000_1/tif7uvi9j8ud5yvutinr1mm79s5su6ih.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 9213565effd88d75970733943bdda5589cfdb7c9506b99ce00b3039a7aa79c2a

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:48 GMT
last-modified: Wed, 13 Mar 2024 13:56:28 GMT
server: nginx
etag: "65f1b08c-7b27"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 31527
expires: Mon, 20 May 2024 12:41:48 GMT

GET
H2 200 cl2hs4xgyalwd2sr2onu3rkgcd89rq3o.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/4fd/320_10000_1/ 30 KB
30 KB 1453ms
458ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/4fd/320_10000_1/cl2hs4xgyalwd2sr2onu3rkgcd89rq3o.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 204a64ce9f2f9676302a7cc1c85c01907361fa8334b6bae07aca9c9e1b252cec

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:48 GMT
last-modified: Wed, 13 Mar 2024 13:37:58 GMT
server: nginx
etag: "65f1ac36-7868"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 30824
expires: Mon, 20 May 2024 12:41:48 GMT

GET
H2 200 kb56fgmp7lozr2kbe92opqf6g8ixtd98.jpeg
13.testfamilygarden.su/upload/resize_cache/iblock/adb/320_10000_1/ 32 KB
32 KB 1903ms
792ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/adb/320_10000_1/kb56fgmp7lozr2kbe92opqf6g8ixtd98.jpeg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 5fefde58a33af4d3087a08e0980364e02a65934b4148972ea8ecde1bc4057f84

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:48 GMT
last-modified: Wed, 13 Mar 2024 13:56:28 GMT
server: nginx
etag: "65f1b08c-7e17"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 32279
expires: Mon, 20 May 2024 12:41:48 GMT

GET
H2 200 96ducbbatwslwzy7fg7l7574wxfesp7n.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/955/320_10000_1/ 27 KB
27 KB 1903ms
792ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/955/320_10000_1/96ducbbatwslwzy7fg7l7574wxfesp7n.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: ea2afa4ef0f67f49e0fdf9ef4fa6a82e39c323627d51605f0073188172939f83

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:48 GMT
last-modified: Wed, 13 Mar 2024 13:56:28 GMT
server: nginx
etag: "65f1b08c-6c99"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 27801
expires: Mon, 20 May 2024 12:41:48 GMT

GET
H2 200 4955qbzaxq7wb5ozpqqr88j718g895w7.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/b33/320_10000_1/ 22 KB
22 KB 1903ms
791ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/b33/320_10000_1/4955qbzaxq7wb5ozpqqr88j718g895w7.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 818a646aaf656d181f790a550abfdcbafa0fb08974f7057467a795df2b96fca8

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:48 GMT
last-modified: Wed, 13 Mar 2024 13:56:28 GMT
server: nginx
etag: "65f1b08c-579e"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 22430
expires: Mon, 20 May 2024 12:41:48 GMT

GET
H2 200 w2hoo1gq1w1ull1jlwvm0ct78tt2kf55.jpg
13.testfamilygarden.su/upload/resize_cache/iblock/445/320_10000_1/ 26 KB
26 KB 1903ms
779ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/resize_cache/iblock/445/320_10000_1/w2hoo1gq1w1ull1jlwvm0ct78tt2kf55.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: aaa1123f7de51ee7045b244699080040f6573afd98cfeef386798e264ca476e3

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:48 GMT
last-modified: Wed, 13 Mar 2024 13:56:28 GMT
server: nginx
etag: "65f1b08c-66cf"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 26319
expires: Mon, 20 May 2024 12:41:48 GMT

GET
H2 200 core.min.js Show response
13.testfamilygarden.su/bitrix/js/main/core/ 211 KB
62 KB 270ms
161ms Script
application/javascript 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to

Full URL: https://13.testfamilygarden.su/bitrix/js/main/core/core.min.js?1710333157216224
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: e47eff3e84b90069a12024203cd8b4814e6997c027d0408ecb7f25abe9003994

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
content-encoding: gzip
last-modified: Wed, 13 Mar 2024 12:32:37 GMT
server: nginx
etag: W/"65f19ce5-34ca0"
vary: Accept-Encoding
content-type: application/javascript; charset=UTF-8
cache-control: max-age=3888000
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 protobuf.min.js Show response
13.testfamilygarden.su/bitrix/js/pull/protobuf/ 75 KB
22 KB 270ms
163ms Script
application/javascript 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to

Full URL: https://13.testfamilygarden.su/bitrix/js/pull/protobuf/protobuf.min.js?171033315576433
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 33bd1842b7778216197b870e8f3b4e387d9511905c04ea5a07934b3c614ef109

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
content-encoding: gzip
last-modified: Wed, 13 Mar 2024 12:32:35 GMT
server: nginx
etag: W/"65f19ce3-12a91"
vary: Accept-Encoding
content-type: application/javascript; charset=UTF-8
cache-control: max-age=3888000
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 model.min.js Show response
13.testfamilygarden.su/bitrix/js/pull/protobuf/ 14 KB
2 KB 270ms
163ms Script
application/javascript 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to

Full URL: https://13.testfamilygarden.su/bitrix/js/pull/protobuf/model.min.js?171033315514190
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 6c9b5de3c1416c5aec8d608287ac497758530c4f8228725bc33e49cbeee28382

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
content-encoding: gzip
last-modified: Wed, 13 Mar 2024 12:32:35 GMT
server: nginx
etag: W/"65f19ce3-376e"
vary: Accept-Encoding
content-type: application/javascript; charset=UTF-8
cache-control: max-age=3888000
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 rest.client.min.js Show response
13.testfamilygarden.su/bitrix/js/rest/client/ 9 KB
3 KB 271ms
163ms Script
application/javascript 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to

Full URL: https://13.testfamilygarden.su/bitrix/js/rest/client/rest.client.min.js?17103331579240
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 5091a00509b006388997b171d01e78296119e41fe88889dfb50f9611bdb17804

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
content-encoding: gzip
last-modified: Wed, 13 Mar 2024 12:32:37 GMT
server: nginx
etag: W/"65f19ce5-2418"
vary: Accept-Encoding
content-type: application/javascript; charset=UTF-8
cache-control: max-age=3888000
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 pull.client.min.js Show response
13.testfamilygarden.su/bitrix/js/pull/client/ 44 KB
11 KB 271ms
164ms Script
application/javascript 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to

Full URL: https://13.testfamilygarden.su/bitrix/js/pull/client/pull.client.min.js?171033315544687
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 964a4d53e48e35c325a87b2569fd2dbdd71c6c15e231a7c2fcdd9a7ae0088507

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
content-encoding: gzip
last-modified: Wed, 13 Mar 2024 12:32:35 GMT
server: nginx
etag: W/"65f19ce3-ae8f"
vary: Accept-Encoding
content-type: application/javascript; charset=UTF-8
cache-control: max-age=3888000
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 template_c13a95baed360884f624aa3e21f33956_v1.js Show response
13.testfamilygarden.su/bitrix/cache/js/f9/injir_dev/template_c13a95baed360884f624aa3e21f33956/ 9 KB
3 KB 270ms
164ms Script
application/javascript 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to

Full URL: https://13.testfamilygarden.su/bitrix/cache/js/f9/injir_dev/template_c13a95baed360884f624aa3e21f33956/template_c13a95baed360884f624aa3e21f33956_v1.js?17104863299046
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: e85fcb0be6237ce7bdb8394f2c4a94e9db149dc50fdd6a118cf549802d1c3125

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
content-encoding: gzip
last-modified: Fri, 15 Mar 2024 07:05:29 GMT
server: nginx
etag: W/"65f3f339-2356"
vary: Accept-Encoding
content-type: application/javascript; charset=UTF-8
cache-control: max-age=3888000
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H3 200 api.js Show response
www.google.com/recaptcha/ 1 KB
883 B 185ms
63ms Script
text/javascript 142.251.35.164
GOOGLE

General

Check archive.org

Show headers Download Go to

Full URL

https://www.google.com/recaptcha/api.js?render=6Lf126cgAAAAAIJ3Urzqt0wmrtyVXcweVwd9z8y5

Requested by

Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/

Protocol

Security

QUIC, , AES_128_GCM

Server

142.251.35.164 Queens, United States, ASN15169 (GOOGLE, US),

Reverse DNS

lga25s78-in-f4.1e100.net

Software

GSE /

Resource Hash

480d0599fa7f00a993adecf4b7d6ff8ce3ea768643fd750b59ad0b40d2726ae6

Security Headers

Name	Value
Content-Security-Policy	frame-ancestors 'self'
X-Content-Type-Options	nosniff
X-Frame-Options	SAMEORIGIN
X-Xss-Protection	1; mode=block

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
content-encoding: gzip
x-content-type-options: nosniff
content-security-policy: frame-ancestors 'self'
server: GSE
x-frame-options: SAMEORIGIN
content-type: text/javascript; charset=utf-8
cache-control: private, max-age=300
cross-origin-resource-policy: cross-origin
alt-svc: h3=":443"; ma=2592000,h3-29=":443"; ma=2592000
x-xss-protection: 1; mode=block
expires: Fri, 05 Apr 2024 12:41:47 GMT

GET
H2 200 / Show response
api-maps.yandex.ru/2.1/ 34 KB
12 KB 568ms
190ms Script
application/javascript 2a02:6b8::274
YANDEX

General

Check archive.org

Show headers Download Go to

Full URL

https://api-maps.yandex.ru/2.1/?lang=ru_RU&coordorder=longlat&apikey=596f8653-37a9-4aca-9e49-73d83164925f

Requested by

Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/

Protocol

Security

TLS 1.3, , AES_256_GCM

Server

2a02:6b8::274 , Russian Federation, ASN13238 (YANDEX, RU),

Reverse DNS

Software

Resource Hash

fa0fb26f6bdf7ec146fa4a57d7ff92f90b3db076682e66432471fd52d8f58328

Security Headers

Name	Value
X-Content-Type-Options	nosniff, nosniff
X-Xss-Protection	1; mode=block

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
content-encoding: gzip
x-content-type-options: nosniff, nosniff
vary: Accept-Encoding, Origin
content-type: application/javascript; charset=utf-8
access-control-allow-origin: *
content-disposition: attachment; filename=json.txt
x-req-id: 1712320907681060-14196706516879949266-jh66c5t2ncewkhw5-BAL
timing-allow-origin: *
x-xss-protection: 1; mode=block
x-start-time: 1712320907681060

GET
H2 200 libs.min.js Show response
13.testfamilygarden.su/local/templates/injir_dev/js/ 317 KB
95 KB 269ms
165ms Script
application/javascript 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to

Full URL: https://13.testfamilygarden.su/local/templates/injir_dev/js/libs.min.js
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 3bbc29438bce3f540f62e5cfa30da319479458594f0f3992a4735bf2cc16be77

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
content-encoding: gzip
last-modified: Wed, 13 Mar 2024 12:35:48 GMT
server: nginx
etag: W/"65f19da4-4f5a2"
vary: Accept-Encoding
content-type: application/javascript; charset=UTF-8
cache-control: max-age=3888000
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 air-datepicker.min.js Show response
13.testfamilygarden.su/local/templates/injir_dev/js/ 47 KB
13 KB 269ms
165ms Script
application/javascript 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to

Full URL: https://13.testfamilygarden.su/local/templates/injir_dev/js/air-datepicker.min.js
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 83ce504460d68aaf5d90404a7035c268521e9a4b28b0c5034a6463cea2958599

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
content-encoding: gzip
last-modified: Wed, 13 Mar 2024 12:35:48 GMT
server: nginx
etag: W/"65f19da4-ba88"
vary: Accept-Encoding
content-type: application/javascript; charset=UTF-8
cache-control: max-age=3888000
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 main.js Show response
13.testfamilygarden.su/local/templates/injir_dev/js/ 18 KB
4 KB 269ms
165ms Script
application/javascript 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to

Full URL: https://13.testfamilygarden.su/local/templates/injir_dev/js/main.js?v=1.1
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: c4bce8d44f0d33288fa41dd2ef131b09efe7864eb6351188fc99e76aa279668a

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
content-encoding: gzip
last-modified: Wed, 13 Mar 2024 12:35:48 GMT
server: nginx
etag: W/"65f19da4-4698"
vary: Accept-Encoding
content-type: application/javascript; charset=UTF-8
cache-control: max-age=3888000
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 jquery.validate.js Show response
13.testfamilygarden.su/local/templates/injir_dev/hbmdev/js/ 64 KB
13 KB 270ms
165ms Script
application/javascript 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to

Full URL: https://13.testfamilygarden.su/local/templates/injir_dev/hbmdev/js/jquery.validate.js
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: b4d5f032063cd6f48a2b46f69c1c7c8e4739c9993fe53c6da6cab8616409b3a8

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
content-encoding: gzip
last-modified: Wed, 13 Mar 2024 12:35:48 GMT
server: nginx
etag: W/"65f19da4-10023"
vary: Accept-Encoding
content-type: application/javascript; charset=UTF-8
cache-control: max-age=3888000
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 script.js Show response
13.testfamilygarden.su/local/templates/injir_dev/hbmdev/js/ 4 KB
1 KB 270ms
166ms Script
application/javascript 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to

Full URL: https://13.testfamilygarden.su/local/templates/injir_dev/hbmdev/js/script.js
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 5cb1e45ae23d8b26684696d51d3d1b9726073cad2d227b560a61a5a258ccf524

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
content-encoding: gzip
last-modified: Wed, 13 Mar 2024 12:35:48 GMT
server: nginx
etag: W/"65f19da4-e69"
vary: Accept-Encoding
content-type: application/javascript; charset=UTF-8
cache-control: max-age=3888000
expires: Mon, 20 May 2024 12:41:47 GMT

GET
H2 200 js Show response
www.googletagmanager.com/gtag/ 278 KB
94 KB 240ms
80ms Script
application/javascript 2607:f8b0:4006:81c::2008
GOOGLE

General

Check archive.org

Show headers Download Go to

Full URL

https://www.googletagmanager.com/gtag/js?id=G-JHVLHWW4WV

Requested by

Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/

Protocol

Security

TLS 1.3, , AES_128_GCM

Server

2607:f8b0:4006:81c::2008 , United States, ASN15169 (GOOGLE, US),

Reverse DNS

Software

Google Tag Manager /

Resource Hash

be981b0d13d53fb94270f245706a2ee5f6d6850718c5c6c6ddc6f563c80389b3

Security Headers

Name	Value
Strict-Transport-Security	max-age=31536000; includeSubDomains
X-Xss-Protection	0

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
content-encoding: br
strict-transport-security: max-age=31536000; includeSubDomains
server: Google Tag Manager
vary: Accept-Encoding
content-type: application/javascript; charset=UTF-8
access-control-allow-origin: *
cache-control: private, max-age=900
access-control-allow-credentials: true
cross-origin-resource-policy: cross-origin
access-control-allow-headers: Cache-Control
content-length: 96315
x-xss-protection: 0
alt-svc: h3=":443"; ma=2592000,h3-29=":443"; ma=2592000
expires: Fri, 05 Apr 2024 12:41:47 GMT

GET
H2 200 v1k75th00yw65focwhl1qfztal8ztoxi.jpg
13.testfamilygarden.su/upload/iblock/2e8/ 1 MB
1 MB 1603ms
775ms Image
image/jpeg 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/iblock/2e8/v1k75th00yw65focwhl1qfztal8ztoxi.jpg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: faf03494b5e496d188fec56c490a136a399ee278c44e9118754518db1781496e

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:48 GMT
last-modified: Wed, 13 Mar 2024 12:38:37 GMT
server: nginx
etag: "65f19e4d-134b73"
content-type: image/jpeg
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 1264499
expires: Mon, 20 May 2024 12:41:48 GMT

GET
H2 200 intro-bg.png
13.testfamilygarden.su/local/templates/injir_dev/img/ 2 KB
3 KB 1096ms
727ms Image
image/png 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/local/templates/injir_dev/img/intro-bg.png
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 3cecf49fbf8644f7b6e15c2f5d046399c1d417cab04b69c340c3d1a1ff0f052b

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:48 GMT
last-modified: Wed, 13 Mar 2024 12:35:48 GMT
server: nginx
etag: "65f19da4-9ab"
content-type: image/png
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 2475
expires: Mon, 20 May 2024 12:41:48 GMT

GET
H2 200 location_white.svg
13.testfamilygarden.su/local/templates/injir_dev/img/icons/ 906 B
1 KB 1148ms
741ms Image
image/svg+xml 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/local/templates/injir_dev/img/icons/location_white.svg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 39c772780a6c9f3afe53255eb60f20439c2fa626ea4cf392def8aecc8b8d1b6d

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:48 GMT
last-modified: Wed, 13 Mar 2024 12:35:48 GMT
server: nginx
etag: "65f19da4-38a"
content-type: image/svg+xml
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 906
expires: Mon, 20 May 2024 12:41:48 GMT

GET
H2 200 about-figure.svg
13.testfamilygarden.su/local/templates/injir_dev/img/ 342 B
520 B 1149ms
742ms Image
image/svg+xml 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/local/templates/injir_dev/img/about-figure.svg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 4634af17253ca8d7bba259e6eb1aa675a698771c10cf5643376d3643af252c90

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:48 GMT
last-modified: Wed, 13 Mar 2024 12:35:48 GMT
server: nginx
etag: "65f19da4-156"
content-type: image/svg+xml
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 342
expires: Mon, 20 May 2024 12:41:48 GMT

GET
H2 200 title-lines.svg
13.testfamilygarden.su/local/templates/injir_dev/img/icons/ 385 B
562 B 1149ms
742ms Image
image/svg+xml 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/local/templates/injir_dev/img/icons/title-lines.svg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: fb2ce73a76c34e4999105888edebc6babed57ad847170109aeee50d4eab48fd8

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:48 GMT
last-modified: Wed, 13 Mar 2024 12:35:48 GMT
server: nginx
etag: "65f19da4-181"
content-type: image/svg+xml
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 385
expires: Mon, 20 May 2024 12:41:48 GMT

GET
H2 200 form-user.svg
13.testfamilygarden.su/local/templates/injir_dev/img/icons/ 1 KB
757 B 1149ms
742ms Image
image/svg+xml 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/local/templates/injir_dev/img/icons/form-user.svg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: d96cc8452ae4add7c02c8ce7012782d18ac036d91c4b88b82a5f2b04610c0284

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:48 GMT
content-encoding: gzip
last-modified: Wed, 13 Mar 2024 12:35:48 GMT
server: nginx
etag: W/"65f19da4-4b8"
vary: Accept-Encoding
content-type: image/svg+xml
cache-control: max-age=3888000
expires: Mon, 20 May 2024 12:41:48 GMT

GET
H2 200 Montserrat-Medium.woff
13.testfamilygarden.su/local/templates/injir_dev/fonts/ 135 KB
136 KB 796ms
586ms Font
application/font-woff 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to

Full URL: https://13.testfamilygarden.su/local/templates/injir_dev/fonts/Montserrat-Medium.woff
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: f16f0ba0ff026f770fe84e32a59c045ec0fdd183d827ac3d854a3578c3b4ff13

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
Origin: https://13.testfamilygarden.su
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:47 GMT
last-modified: Wed, 13 Mar 2024 12:35:48 GMT
server: nginx
accept-ranges: bytes
etag: "21d14-6138a03b56b35"
content-length: 138516
content-type: application/font-woff

GET
H2 200 form-location.svg
13.testfamilygarden.su/local/templates/injir_dev/img/icons/ 915 B
1 KB 1125ms
742ms Image
image/svg+xml 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/local/templates/injir_dev/img/icons/form-location.svg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: a47984c6e030b85e882529c3fac2224aa368e37ce6dbd3c10996c77da488d5ef

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:48 GMT
last-modified: Wed, 13 Mar 2024 12:35:48 GMT
server: nginx
etag: "65f19da4-393"
content-type: image/svg+xml
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 915
expires: Mon, 20 May 2024 12:41:48 GMT

GET
H2 200 2pticguxbcxnp1qexghqe75zoznizwzt.png
13.testfamilygarden.su/upload/iblock/6fd/ 69 KB
69 KB 1570ms
762ms Image
image/png 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/iblock/6fd/2pticguxbcxnp1qexghqe75zoznizwzt.png
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: cfac6f2b21bde058afdc42bc6b28cc6b5347bd2d601e22a6a224376920f29c84

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:48 GMT
last-modified: Wed, 13 Mar 2024 12:38:30 GMT
server: nginx
etag: "65f19e46-114ed"
content-type: image/png
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 70893
expires: Mon, 20 May 2024 12:41:48 GMT

GET
H2 200 time_w.svg
13.testfamilygarden.su/local/templates/injir_dev/img/icons/ 415 B
593 B 1946ms
867ms Image
image/svg+xml 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/local/templates/injir_dev/img/icons/time_w.svg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: dd064f19db9c939c6b717410ea488cdf3f408a974f4ab140327912c9760e5273

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:48 GMT
last-modified: Wed, 13 Mar 2024 12:35:48 GMT
server: nginx
etag: "65f19da4-19f"
content-type: image/svg+xml
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 415
expires: Mon, 20 May 2024 12:41:48 GMT

GET
H2 200 heart_w.svg
13.testfamilygarden.su/local/templates/injir_dev/img/icons/ 813 B
991 B 1946ms
866ms Image
image/svg+xml 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/local/templates/injir_dev/img/icons/heart_w.svg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 40df8d37c82a1abce04a1b68d8aec8b39c9c7a5254a7abdc3f52227dae45c4bf

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:48 GMT
last-modified: Wed, 13 Mar 2024 12:35:48 GMT
server: nginx
etag: "65f19da4-32d"
content-type: image/svg+xml
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 813
expires: Mon, 20 May 2024 12:41:48 GMT

GET
H2 200 sale_w.svg
13.testfamilygarden.su/local/templates/injir_dev/img/icons/ 905 B
1 KB 1946ms
866ms Image
image/svg+xml 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/local/templates/injir_dev/img/icons/sale_w.svg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 1343e117aa1fb53f0892e90fe4a76b4d0224e677fd510a46fb8e7c28ba6c6fd5

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:48 GMT
last-modified: Wed, 13 Mar 2024 12:35:48 GMT
server: nginx
etag: "65f19da4-389"
content-type: image/svg+xml
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 905
expires: Mon, 20 May 2024 12:41:48 GMT

GET
H2 200 call.svg
13.testfamilygarden.su/local/templates/injir_dev/img/icons/ 822 B
1000 B 1946ms
858ms Image
image/svg+xml 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/local/templates/injir_dev/img/icons/call.svg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: be2c5de4c598954edbcf55fa036eba2c3d82e4ae31b353d67e9f6b89659a87e9

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:48 GMT
last-modified: Wed, 13 Mar 2024 12:35:48 GMT
server: nginx
etag: "65f19da4-336"
content-type: image/svg+xml
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 822
expires: Mon, 20 May 2024 12:41:48 GMT

GET
H2 200 mail.svg
13.testfamilygarden.su/local/templates/injir_dev/img/icons/ 737 B
914 B 1947ms
857ms Image
image/svg+xml 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/local/templates/injir_dev/img/icons/mail.svg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: e0c656a40f9a5b41b9f51b6e4f71d67cffef5cf3c2f80226a1c4688f2267fdb1

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:48 GMT
last-modified: Wed, 13 Mar 2024 12:35:48 GMT
server: nginx
etag: "65f19da4-2e1"
content-type: image/svg+xml
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 737
expires: Mon, 20 May 2024 12:41:48 GMT

GET
H2 200 Montserrat-SemiBold.woff
13.testfamilygarden.su/local/templates/injir_dev/fonts/ 135 KB
135 KB 1062ms
728ms Font
application/font-woff 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to

Full URL: https://13.testfamilygarden.su/local/templates/injir_dev/fonts/Montserrat-SemiBold.woff
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: e47879993ba04778087685eb53bfc03caf05da15f89f87aec961bf7aa638817d

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
Origin: https://13.testfamilygarden.su
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:48 GMT
last-modified: Wed, 13 Mar 2024 12:35:48 GMT
server: nginx
accept-ranges: bytes
etag: "21bf8-6138a03b56365"
content-length: 138232
content-type: application/font-woff

GET
H2 200 Montserrat-Bold.woff
13.testfamilygarden.su/local/templates/injir_dev/fonts/ 136 KB
136 KB 1062ms
729ms Font
application/font-woff 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to

Full URL: https://13.testfamilygarden.su/local/templates/injir_dev/fonts/Montserrat-Bold.woff
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: e1632dc38a09dce6cb13781150c5c2559762113ac2fb5d3509827b2e23223742

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
Origin: https://13.testfamilygarden.su
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:48 GMT
last-modified: Wed, 13 Mar 2024 12:35:48 GMT
server: nginx
accept-ranges: bytes
etag: "21e94-6138a03b553c5"
content-length: 138900
content-type: application/font-woff

GET
H2 200 Montserrat-Regular.woff
13.testfamilygarden.su/local/templates/injir_dev/fonts/ 135 KB
136 KB 1060ms
728ms Font
application/font-woff 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to

Full URL: https://13.testfamilygarden.su/local/templates/injir_dev/fonts/Montserrat-Regular.woff
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 215a175ce4fe873fe5ccb95770980ce28b5e46b844cd459f619e8371d5effc1e

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
Origin: https://13.testfamilygarden.su
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:48 GMT
last-modified: Wed, 13 Mar 2024 12:35:48 GMT
server: nginx
accept-ranges: bytes
etag: "21d68-6138a03b557ad"
content-length: 138600
content-type: application/font-woff

GET
H2 200 Montserrat-ExtraBold.woff
13.testfamilygarden.su/local/templates/injir_dev/fonts/ 135 KB
136 KB 1060ms
729ms Font
application/font-woff 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to

Full URL: https://13.testfamilygarden.su/local/templates/injir_dev/fonts/Montserrat-ExtraBold.woff
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 5ba170e9a1187ca539fbb55c6ac8ab845546d6a93b502826037f8882bf0a8471

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
Origin: https://13.testfamilygarden.su
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:48 GMT
last-modified: Wed, 13 Mar 2024 12:35:48 GMT
server: nginx
accept-ranges: bytes
etag: "21df4-6138a03b56f1d"
content-length: 138740
content-type: application/font-woff

GET
H2 200 resize.svg
13.testfamilygarden.su/local/templates/injir_dev/img/icons/ 239 B
416 B 1944ms
856ms Image
image/svg+xml 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/local/templates/injir_dev/img/icons/resize.svg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: cc423bd69fa3a31e88cf0ab7fbd9a6f07b77e156d64c985149da5e31edc795ea

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:48 GMT
last-modified: Wed, 13 Mar 2024 12:35:48 GMT
server: nginx
etag: "65f19da4-ef"
content-type: image/svg+xml
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 239
expires: Mon, 20 May 2024 12:41:48 GMT

GET
H2 200 Montserrat-Light.woff
13.testfamilygarden.su/local/templates/injir_dev/fonts/ 134 KB
134 KB 1059ms
728ms Font
application/font-woff 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to

Full URL: https://13.testfamilygarden.su/local/templates/injir_dev/fonts/Montserrat-Light.woff
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: e86993249b62a7a0bc14f7bb8525b5a8bb5d8535fd24fd14e57efd44b55b5e84

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
Origin: https://13.testfamilygarden.su
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:48 GMT
last-modified: Wed, 13 Mar 2024 12:35:48 GMT
server: nginx
accept-ranges: bytes
etag: "218b0-6138a03b576ed"
content-length: 137392
content-type: application/font-woff

GET
H2 200 ba.js Show response
bitrix.info/ 7 KB
3 KB 389ms
117ms Script
application/javascript 52.209.148.209
AMAZON-02

General

Check archive.org

Show headers Download Go to

Full URL

https://bitrix.info/ba.js

Requested by

Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/

Protocol

Security

TLS 1.2, ECDHE_RSA, AES_128_GCM

Server

52.209.148.209 Dublin, Ireland, ASN16509 (AMAZON-02, US),

Reverse DNS

ec2-52-209-148-209.eu-west-1.compute.amazonaws.com

Software

nginx/1.24.0 /

Resource Hash

897c58672b375fd206d4df4ccd71a3fa3e29f739f4db5251b94895ad015f9710

Security Headers

Name	Value
Strict-Transport-Security	max-age=63072000

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:48 GMT
strict-transport-security: max-age=63072000
content-encoding: gzip
last-modified: Wed, 19 May 2021 09:38:44 GMT
server: nginx/1.24.0
etag: W/"60a4dca4-1a03"
p3p: CP="NOI ADM DEV PSAi COM NAV OUR OTRo STP IND DEM"
access-control-allow-origin: *
content-type: application/javascript
cache-control: max-age=172800
expires: Sun, 07 Apr 2024 12:41:48 GMT

GET
H2 200 spread.php
testfamilygarden.su/bitrix/ 0
459 B 1334ms
427ms Image
text/html 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://testfamilygarden.su/bitrix/spread.php?s=QklUUklYX1NNX1NBTEVfVUlEATQ4ZjVkMzMwY2E2MTczOWU3ZDFkMmZkNDBlNWIyMGRkATE3NDM0MjQ5MDYBLwEBAQI%3D&k=0b8c405e44ad9eb97657f5a2a2c0d859
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx / PHP/7.4.33
Resource Hash: e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

pragma: no-cache
date: Fri, 05 Apr 2024 12:41:49 GMT
server: nginx
x-powered-by: PHP/7.4.33
p3p: policyref="/bitrix/p3p.xml", CP="NON DSP COR CUR ADM DEV PSA PSD OUR UNR BUS UNI COM NAV INT DEM STA"
x-powered-cms: Bitrix Site Manager (7e683df94889b2cec79b7292a3574edf)
content-type: text/html; charset=UTF-8
cache-control: no-store, no-cache, must-revalidate
x-devsrv-cms: Bitrix
content-length: 0
expires: Thu, 19 Nov 1981 08:52:00 GMT

GET
H2 200 recaptcha__en.js Show response
www.gstatic.com/recaptcha/releases/moV1mTgQ6S91nuTnmll4Y9yf/ 499 KB
199 KB 152ms
46ms Script
text/javascript 2607:f8b0:4006:822::2003
GOOGLE

General

Check archive.org

Show headers Download Go to

Full URL

https://www.gstatic.com/recaptcha/releases/moV1mTgQ6S91nuTnmll4Y9yf/recaptcha__en.js

Requested by

Host: www.google.com
URL: https://www.google.com/recaptcha/api.js?render=6Lf126cgAAAAAIJ3Urzqt0wmrtyVXcweVwd9z8y5

Protocol

Security

TLS 1.3, , AES_128_GCM

Server

2607:f8b0:4006:822::2003 , United States, ASN15169 (GOOGLE, US),

Reverse DNS

Software

sffe /

Resource Hash

f3756825df5194a174b7a55ebd3b484c276766eef21343d34b053b98ed386801

Security Headers

Name	Value
X-Content-Type-Options	nosniff
X-Xss-Protection	0

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
Origin: https://13.testfamilygarden.su
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 11:59:37 GMT
content-encoding: gzip
x-content-type-options: nosniff
age: 2531
content-security-policy-report-only: require-trusted-types-for 'script'; report-uri https://csp.withgoogle.com/csp/recaptcha
cross-origin-resource-policy: cross-origin
alt-svc: h3=":443"; ma=2592000,h3-29=":443"; ma=2592000
content-length: 203410
x-xss-protection: 0
last-modified: Mon, 25 Mar 2024 04:00:24 GMT
server: sffe
cross-origin-opener-policy: same-origin-allow-popups; report-to="recaptcha"
vary: Accept-Encoding
report-to: {"group":"recaptcha","max_age":2592000,"endpoints":[{"url":"https://csp.withgoogle.com/csp/report-to/recaptcha"}]}
content-type: text/javascript
access-control-allow-origin: *
cache-control: public, max-age=31536000
accept-ranges: bytes
expires: Sat, 05 Apr 2025 11:59:37 GMT

GET
H2 200 full-f7815554a5a1454cb96dbe8680afeb6e7a6e1cb5.js Show response
yastatic.net/s3/front-maps-static/maps-front-jsapi-v2-1/2.1.79-13725638/build/release/ 3 MB
676 KB 458ms
219ms Script
application/javascript 2a02:6b8:20::215
YANDEX

General

Check archive.org

Show headers Download Go to

Full URL

https://yastatic.net/s3/front-maps-static/maps-front-jsapi-v2-1/2.1.79-13725638/build/release/full-f7815554a5a1454cb96dbe8680afeb6e7a6e1cb5.js

Requested by

Host: api-maps.yandex.ru
URL: https://api-maps.yandex.ru/2.1/?lang=ru_RU&coordorder=longlat&apikey=596f8653-37a9-4aca-9e49-73d83164925f

Protocol

Security

TLS 1.3, , AES_256_GCM

Server

2a02:6b8:20::215 , Russian Federation, ASN13238 (YANDEX, RU),

Reverse DNS

Software

nginx/1.17.9 /

Resource Hash

766c76c75e53c41a6d3da422605d0030f86258ac36616a76f24a544f6cae3c1d

Security Headers

Name	Value
Strict-Transport-Security	max-age=43200000; includeSubDomains;

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:48 GMT
content-encoding: br
strict-transport-security: max-age=43200000; includeSubDomains;
last-modified: Wed, 27 Mar 2024 12:08:35 GMT
server: nginx/1.17.9
nel: {"report_to": "network-errors", "max_age": 7200, "success_fraction": 0.001, "failure_fraction": 0.01}
etag: W/"0336b234fef88edcc4fee6145ce3675b"
vary: Accept-Encoding
report-to: { "group": "network-errors", "max_age": 7200, "endpoints": [ { "url": "https://dr.yandex.net/nel"}]}
content-type: application/javascript; charset=utf-8
access-control-allow-origin: *
cache-control: public, max-age=31556952
x-nginx-request-id: b27b833068ec18ce
timing-allow-origin: *
expires: Sat, 05 Apr 2025 18:27:39 GMT

GET
H2 200 tag.js Show response
mc.yandex.ru/metrika/ 210 KB
73 KB 655ms
307ms Script
application/javascript 2a02:6b8::1:119
YANDEX

General

Check archive.org

Show headers Download Go to

Full URL

https://mc.yandex.ru/metrika/tag.js

Requested by

Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/

Protocol

Security

TLS 1.3, , AES_256_GCM

Server

2a02:6b8::1:119 , Russian Federation, ASN13238 (YANDEX, RU),

Reverse DNS

Software

Resource Hash

90f21e0997ee4fca652d5aad8ccc321718c1eacfafc62974d3e6e8b289df95bd

Security Headers

Name	Value
Strict-Transport-Security	max-age=31536000

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:48 GMT
content-encoding: br
strict-transport-security: max-age=31536000
last-modified: Fri, 05 Apr 2024 08:05:36 GMT
accept-ch: Sec-CH-UA-Bitness, Sec-CH-UA-Arch, Sec-CH-UA-Full-Version, Sec-CH-UA-Mobile, Sec-CH-UA-Model, Sec-CH-UA-Platform-Version, Sec-CH-UA-Full-Version-List, Sec-CH-UA-Platform, Sec-CH-UA, UA-Bitness, UA-Arch, UA-Full-Version, UA-Mobile, UA-Model, UA-Platform-Version, UA-Platform, UA
etag: "660fb0d0-120aa"
content-type: application/javascript
access-control-allow-origin: *
cache-control: max-age=3600
timing-allow-origin: *
content-length: 73898
expires: Fri, 05 Apr 2024 13:41:48 GMT

POST
H2 200 ajax_counter.php Show response
13.testfamilygarden.su/bitrix/tools/conversion/ 2 B
559 B 542ms
476ms XHR
text/html 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to

Full URL: https://13.testfamilygarden.su/bitrix/tools/conversion/ajax_counter.php
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx / PHP/7.4.33
Resource Hash: 565339bc4d33d72817b583024112eb7f5cdf3e5eef0252d6ec1b9c9a94e12bb3

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
sec-ch-ua-platform: "Win32"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
Content-type: application/x-www-form-urlencoded

Response headers

pragma: no-cache
date: Fri, 05 Apr 2024 12:41:48 GMT
content-encoding: gzip
server: nginx
x-powered-by: PHP/7.4.33
vary: Accept-Encoding
p3p: policyref="/bitrix/p3p.xml", CP="NON DSP COR CUR ADM DEV PSA PSD OUR UNR BUS UNI COM NAV INT DEM STA"
x-powered-cms: Bitrix Site Manager (7e683df94889b2cec79b7292a3574edf)
content-type: text/html; charset=UTF-8
cache-control: no-store, no-cache, must-revalidate
x-devsrv-cms: Bitrix
expires: Thu, 19 Nov 1981 08:52:00 GMT

POST
H2 204 collect
www.google-analytics.com/g/ 0
259 B 170ms
54ms Ping
text/plain 2607:f8b0:4006:823::200e
GOOGLE

General

Check archive.org

Show headers Download Go to

Full URL: https://www.google-analytics.com/g/collect?v=2&tid=G-JHVLHWW4WV&gtm=45je4430v897832969za200&_p=1712320908148&gcd=13l3l3l3l1&npa=0&dma=0&cid=1493710073.1712320908&ul=en-us&sr=800x600&uaa=x86&uab=64&uafvl=Google%2520Chrome%3B123.0.6312.105%7CNot%253AA-Brand%3B8.0.0.0%7CChromium%3B123.0.6312.105&uamb=0&uam=&uap=Win32&uapv=10.0.0&uaw=0&pscdl=noapi&_s=1&sid=1712320908&sct=1&seg=0&dl=https%3A%2F%2F13.testfamilygarden.su%2F&dt=%D0%A0%D0%B5%D1%81%D1%82%D0%BE%D1%80%D0%B0%D0%BD%20%E2%84%9613%20%D0%B2%20%D0%A1%D0%BE%D1%87%D0%B8%20%D0%BD%D0%B0%20%D0%9C%D0%B0%D0%BD%D0%B4%D0%B0%D1%80%D0%B8%D0%BD%D0%B5.%20%D0%90%D0%B2%D1%82%D0%BE%D1%80%D1%81%D0%BA%D0%B0%D1%8F%20%D0%BA%D1%83%D1%85%D0%BD%D1%8F%2C%20%D0%B1%D1%80%D0%BE%D0%BD%D0%B8%D1%80%D0%BE%D0%B2%D0%B0%D0%BD%D0%B8%D0%B5%20%D1%81%D1%82%D0%BE%D0%BB%D0%BE%D0%B2%2C%20%D0%BC%D0%B5%D0%BD%D1%8E%2C%20%D1%86%D0%B5%D0%BD%D1%8B%2C%20%D0%B4%D0%BE%D1%81%D1%82%D0%B0%D0%B2%D0%BA%D0%B0%20%D0%B5%D0%B4%D1%8B%20%7C%20%D0%9E%D1%84%D0%B8%D1%86%D0%B8%D0%B0%D0%BB%D1%8C%D0%BD%D1%8B%D0%B9%20%D1%81%D0%B0%D0%B9%D1%82%20%E2%80%A2%2013&en=page_view&_fv=1&_nsi=1&_ss=1&_ee=1&tfd=3053
Requested by: Host: www.googletagmanager.com
URL: https://www.googletagmanager.com/gtag/js?id=G-JHVLHWW4WV
Protocol: H2
Security: TLS 1.3, , AES_128_GCM
Server: 2607:f8b0:4006:823::200e , United States, ASN15169 (GOOGLE, US),
Reverse DNS
Software: Golfe2 /
Resource Hash: e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

pragma: no-cache
date: Fri, 05 Apr 2024 12:41:48 GMT
server: Golfe2
content-type: text/plain
access-control-allow-origin: https://13.testfamilygarden.su
cache-control: no-cache, no-store, must-revalidate
access-control-allow-credentials: true
cross-origin-resource-policy: cross-origin
alt-svc: h3=":443"; ma=2592000,h3-29=":443"; ma=2592000
content-length: 0
expires: Fri, 01 Jan 1990 00:00:00 GMT

GET
H2 200 arrow.svg
13.testfamilygarden.su/local/templates/injir_dev/img/icons/ 188 B
365 B 1313ms
829ms Image
image/svg+xml 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/local/templates/injir_dev/img/icons/arrow.svg
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: 09c0be0a371bb33ba741c05be1c160c7b404a395dd53ae1d6b9a64bf6c8e0317

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/local/templates/injir_dev/css/style.css
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:48 GMT
last-modified: Wed, 13 Mar 2024 12:35:48 GMT
server: nginx
etag: "65f19da4-bc"
content-type: image/svg+xml
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 188
expires: Mon, 20 May 2024 12:41:48 GMT

GET
H3 200 anchor
www.google.com/recaptcha/api2/ Frame B0AE 0
0 164ms
65ms Document
text/html 142.251.35.164
GOOGLE

General

Check archive.org

Show headers Download Go to

Full URL

https://www.google.com/recaptcha/api2/anchor?ar=1&k=6Lf126cgAAAAAIJ3Urzqt0wmrtyVXcweVwd9z8y5&co=aHR0cHM6Ly8xMy50ZXN0ZmFtaWx5Z2FyZGVuLnN1OjQ0Mw..&hl=en&v=moV1mTgQ6S91nuTnmll4Y9yf&size=invisible&cb=ssx0sg4j8mrx

Requested by

Host: www.gstatic.com
URL: https://www.gstatic.com/recaptcha/releases/moV1mTgQ6S91nuTnmll4Y9yf/recaptcha__en.js

Protocol

Security

QUIC, , AES_128_GCM

Server

142.251.35.164 Queens, United States, ASN15169 (GOOGLE, US),

Reverse DNS

lga25s78-in-f4.1e100.net

Software

GSE /

Resource Hash

Security Headers

Name	Value
Content-Security-Policy	script-src 'report-sample' 'nonce-sNor4CE1gNraS2tuHZUj9A' 'unsafe-inline' 'strict-dynamic' https: http: 'unsafe-eval';object-src 'none';base-uri 'self';report-uri https://csp.withgoogle.com/csp/recaptcha/1
X-Content-Type-Options	nosniff
X-Xss-Protection	1; mode=block

Request headers

Referer: https://13.testfamilygarden.su/
Upgrade-Insecure-Requests: 1
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
accept-language: en-US,en;q=0.9
sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
sec-ch-ua-mobile: ?0
sec-ch-ua-platform: "Win32"

Response headers

alt-svc: h3=":443"; ma=2592000,h3-29=":443"; ma=2592000
cache-control: private, max-age=0
content-encoding: gzip
content-security-policy: script-src 'report-sample' 'nonce-sNor4CE1gNraS2tuHZUj9A' 'unsafe-inline' 'strict-dynamic' https: http: 'unsafe-eval';object-src 'none';base-uri 'self';report-uri https://csp.withgoogle.com/csp/recaptcha/1
content-type: text/html; charset=utf-8
cross-origin-embedder-policy: require-corp
cross-origin-resource-policy: cross-origin
date: Fri, 05 Apr 2024 12:41:48 GMT
expires: Fri, 05 Apr 2024 12:41:48 GMT
report-to: {"group":"recaptcha","max_age":2592000,"endpoints":[{"url":"https://csp.withgoogle.com/csp/report-to/recaptcha"}]}
server: GSE
x-content-type-options: nosniff
x-xss-protection: 1; mode=block

POST
H2 200 bx_stat Show response
bitrix.info/ 42 B
367 B 132ms
131ms XHR
text/plain 52.209.148.209
AMAZON-02

General

Check archive.org

Show headers Download Go to

Full URL: https://bitrix.info/bx_stat
Requested by: Host: bitrix.info
URL: https://bitrix.info/ba.js
Protocol: H2
Security: TLS 1.2, ECDHE_RSA, AES_128_GCM
Server: 52.209.148.209 Dublin, Ireland, ASN16509 (AMAZON-02, US),
Reverse DNS: ec2-52-209-148-209.eu-west-1.compute.amazonaws.com
Software: nginx/1.24.0 /
Resource Hash: 2fc899c40b90c5c41d2e533697dd8eb778b3b3b0c57b4888f330402f9da1fe4d

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
sec-ch-ua-platform: "Win32"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
Content-Type: application/x-www-form-urlencoded

Response headers

access-control-allow-origin: https://13.testfamilygarden.su
date: Fri, 05 Apr 2024 12:41:48 GMT
access-control-allow-credentials: true
server: nginx/1.24.0
etag: 571ece508c8c4bd046ce9baf40d540dd
p3p: CP="NOI ADM DEV PSAi COM NAV OUR OTRo STP IND DEM"

GET
H2

200

sync_cookie_image_decide
mc.yandex.com/
Redirect Chain

https://mc.yandex.com/sync_cookie_image_check
https://mc.yandex.ru/sync_cookie_image_start?redirect_domain=mc.yandex.com&token=10330.b9oCx27y4EbwoW8lfjzo2p08P_ETxek2C14kbzPaXEoeJ7fH4NlGOfk9Tf7kXmLE.4v_PEwi5mCO3X66s5py5iIeWTlw%2C
https://mc.yandex.com/sync_cookie_image_decide?token=10330.xWOtNIkA05AhPbY-cPAgSUaUpx77BRfu3AY9862Sp1QYhKVhfPcsra86J9gohz5-skDoHac1wvBTu4k20hnhB78hOiAeoe8N6IfghotypXNb2kYlow_R_w7pwDQQY94TeAjY6LfCzD...

43 B
672 B

166ms
166ms

Image
image/gif

2a02:6b8::1:119
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL

https://mc.yandex.com/sync_cookie_image_decide?token=10330.xWOtNIkA05AhPbY-cPAgSUaUpx77BRfu3AY9862Sp1QYhKVhfPcsra86J9gohz5-skDoHac1wvBTu4k20hnhB78hOiAeoe8N6IfghotypXNb2kYlow_R_w7pwDQQY94TeAjY6LfCzDSfENwhWan0mX4-7MQJLh82AEplMCX29sR9Tb33IU-KY92bsQI9B_jOkUt4tV4Tuo_IIGlO41BPDJSbj3GMTg7ttgQD7_zXJRU%2C.ZGz4GkdT8FrjdGF-9OavmBvLfZ8%2C

Requested by

Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/

Protocol

Server

2a02:6b8::1:119 , Russian Federation, ASN13238 (YANDEX, RU),

Reverse DNS

Software

Resource Hash

548f2d6f4d0d820c6c5ffbeffcbd7f0e73193e2932eefe542accc84762deec87

Security Headers

Name	Value
Strict-Transport-Security	max-age=31536000
X-Xss-Protection	1; mode=block

Request headers

accept-language: en-US,en;q=0.9
Referer: https://13.testfamilygarden.su/
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36

Response headers

date: Fri, 05 Apr 2024 12:41:49 GMT
strict-transport-security: max-age=31536000
content-length: 43
x-xss-protection: 1; mode=block
content-type: image/gif

Redirect headers

location: https://mc.yandex.com/sync_cookie_image_decide?token=10330.xWOtNIkA05AhPbY-cPAgSUaUpx77BRfu3AY9862Sp1QYhKVhfPcsra86J9gohz5-skDoHac1wvBTu4k20hnhB78hOiAeoe8N6IfghotypXNb2kYlow_R_w7pwDQQY94TeAjY6LfCzDSfENwhWan0mX4-7MQJLh82AEplMCX29sR9Tb33IU-KY92bsQI9B_jOkUt4tV4Tuo_IIGlO41BPDJSbj3GMTg7ttgQD7_zXJRU%2C.ZGz4GkdT8FrjdGF-9OavmBvLfZ8%2C
date: Fri, 05 Apr 2024 12:41:49 GMT
strict-transport-security: max-age=31536000
x-xss-protection: 1; mode=block

GET
H2 200 advert.gif
mc.yandex.com/metrika/ 43 B
595 B 175ms
162ms Image
image/gif 2a02:6b8::1:119
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL

https://mc.yandex.com/metrika/advert.gif

Requested by

Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/

Protocol

Security

TLS 1.3, , AES_256_GCM

Server

2a02:6b8::1:119 , Russian Federation, ASN13238 (YANDEX, RU),

Reverse DNS

Software

Resource Hash

548f2d6f4d0d820c6c5ffbeffcbd7f0e73193e2932eefe542accc84762deec87

Security Headers

Name	Value
Strict-Transport-Security	max-age=31536000

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:49 GMT
strict-transport-security: max-age=31536000
last-modified: Fri, 05 Apr 2024 08:05:36 GMT
accept-ch: Sec-CH-UA-Bitness, Sec-CH-UA-Arch, Sec-CH-UA-Full-Version, Sec-CH-UA-Mobile, Sec-CH-UA-Model, Sec-CH-UA-Platform-Version, Sec-CH-UA-Full-Version-List, Sec-CH-UA-Platform, Sec-CH-UA, UA-Bitness, UA-Arch, UA-Full-Version, UA-Mobile, UA-Model, UA-Platform-Version, UA-Platform, UA
etag: "660fb0d0-2b"
content-type: image/gif
access-control-allow-origin: *
cache-control: max-age=3600
accept-ranges: bytes
timing-allow-origin: *
content-length: 43
expires: Fri, 05 Apr 2024 13:41:49 GMT

GET
H2 200 grab.cur
api-maps.yandex.ru/2.1.79/build/release/images/cursor/ 326 B
697 B 163ms
161ms Image
application/octet-stream 2a02:6b8::274
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://api-maps.yandex.ru/2.1.79/build/release/images/cursor/grab.cur
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a02:6b8::274 , Russian Federation, ASN13238 (YANDEX, RU),
Reverse DNS
Software: /
Resource Hash: 13e327b334d10b2b24101040eecace86aaaa2eed03d282fa75a04aa3bebf69c1

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

expires: Thu, 31 Dec 2037 23:55:55 GMT
date: Fri, 05 Apr 2024 12:41:49 GMT
last-modified: Wed, 27 Mar 2024 12:08:48 GMT
etag: "66040c50-146"
content-type: application/octet-stream
access-control-allow-origin: *
cache-control: max-age=315360000, public
x-req-id: 1712320909577261-13259644045835943188-jh66c5t2ncewkhw5-BAL
accept-ranges: bytes
content-length: 326
x-start-time: 1712320909577261

GET
H2 200 grabbing.cur
api-maps.yandex.ru/2.1.79/build/release/images/cursor/ 326 B
529 B 172ms
171ms Image
application/octet-stream 2a02:6b8::274
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://api-maps.yandex.ru/2.1.79/build/release/images/cursor/grabbing.cur
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a02:6b8::274 , Russian Federation, ASN13238 (YANDEX, RU),
Reverse DNS
Software: /
Resource Hash: a0fb89588dc7b711c0ffddb5fa2f6852f670ef1f615985bb65b2ea446cceb79f

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

expires: Thu, 31 Dec 2037 23:55:55 GMT
date: Fri, 05 Apr 2024 12:41:49 GMT
last-modified: Wed, 27 Mar 2024 12:08:48 GMT
etag: "66040c50-146"
content-type: application/octet-stream
access-control-allow-origin: *
cache-control: max-age=315360000, public
x-req-id: 1712320909577529-12383471840909060419-jh66c5t2ncewkhw5-BAL
accept-ranges: bytes
content-length: 326
x-start-time: 1712320909577529

GET
H2 200 help.cur
api-maps.yandex.ru/2.1.79/build/release/images/cursor/ 326 B
530 B 201ms
200ms Image
application/octet-stream 2a02:6b8::274
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://api-maps.yandex.ru/2.1.79/build/release/images/cursor/help.cur
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a02:6b8::274 , Russian Federation, ASN13238 (YANDEX, RU),
Reverse DNS
Software: /
Resource Hash: 128811e08fc761c192794eadb0ca1ece135e0b3a8ea7d897c2f7f9fd5a37281f

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

expires: Thu, 31 Dec 2037 23:55:55 GMT
date: Fri, 05 Apr 2024 12:41:49 GMT
last-modified: Wed, 27 Mar 2024 12:08:48 GMT
etag: "66040c50-146"
content-type: application/octet-stream
access-control-allow-origin: *
cache-control: max-age=315360000, public
x-req-id: 1712320909577680-8326638051828228816-jh66c5t2ncewkhw5-BAL
accept-ranges: bytes
content-length: 326
x-start-time: 1712320909577680

GET
H2 200 zoom_in.cur
api-maps.yandex.ru/2.1.79/build/release/images/cursor/ 326 B
529 B 172ms
171ms Image
application/octet-stream 2a02:6b8::274
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://api-maps.yandex.ru/2.1.79/build/release/images/cursor/zoom_in.cur
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a02:6b8::274 , Russian Federation, ASN13238 (YANDEX, RU),
Reverse DNS
Software: /
Resource Hash: eb69f540be1e416b7346017da48deaf5ba2f2ee0af366c04f1e374351b651872

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

expires: Thu, 31 Dec 2037 23:55:55 GMT
date: Fri, 05 Apr 2024 12:41:49 GMT
last-modified: Wed, 27 Mar 2024 12:08:48 GMT
etag: "66040c50-146"
content-type: application/octet-stream
access-control-allow-origin: *
cache-control: max-age=315360000, public
x-req-id: 1712320909577810-9183806236713858922-jh66c5t2ncewkhw5-BAL
accept-ranges: bytes
content-length: 326
x-start-time: 1712320909577810

GET
H2

200

1 Show response
mc.yandex.com/watch/89347546/
Redirect Chain

https://mc.yandex.com/watch/89347546?wmode=7&page-url=https%3A%2F%2F13.testfamilygarden.su%2F&charset=utf-8&uah=chu%0A%22Google%20Chrome%22%3Bv%3D%22123%22%2C%22Not%3AA-Brand%22%3Bv%3D%228%22%2C%22...
https://mc.yandex.com/watch/89347546/1?wmode=7&page-url=https%3A%2F%2F13.testfamilygarden.su%2F&charset=utf-8&uah=chu%0A%22Google%20Chrome%22%3Bv%3D%22123%22%2C%22Not%3AA-Brand%22%3Bv%3D%228%22%2C%...

454 B
546 B

160ms
160ms

Fetch
application/json

2a02:6b8::1:119
YANDEX

General

Check archive.org

Show headers Download Go to

Full URL

https://mc.yandex.com/watch/89347546/1?wmode=7&page-url=https%3A%2F%2F13.testfamilygarden.su%2F&charset=utf-8&uah=chu%0A%22Google%20Chrome%22%3Bv%3D%22123%22%2C%22Not%3AA-Brand%22%3Bv%3D%228%22%2C%22Chromium%22%3Bv%3D%22123%22%0Acha%0Ax86%0Achb%0A64%0Achf%0A123.0.6312.105%0Achl%0A%22Google%20Chrome%22%3Bv%3D%22123.0.6312.105%22%2C%22Not%3AA-Brand%22%3Bv%3D%228.0.0.0%22%2C%22Chromium%22%3Bv%3D%22123.0.6312.105%22%0Achm%0A%3F0%0Achp%0AWin32%0Achv%0A10.0.0&browser-info=pv%3A1%3Avf%3A6q5vo8idydw3m5q59jr2ws8gr%3Afu%3A0%3Aen%3Autf-8%3Ala%3Aen-US%3Av%3A1290%3Acn%3A1%3Adp%3A0%3Als%3A1670844702263%3Ahid%3A748472765%3Az%3A-600%3Ai%3A20240405024149%3Aet%3A1712320909%3Ac%3A1%3Arn%3A947008341%3Arqn%3A1%3Au%3A1712320909960520166%3Aw%3A1600x1113%3As%3A800x600x24%3Ask%3A1%3Afp%3A2703%3Awv%3A2%3Ads%3A0%2C345%2C1068%2C2%2C0%2C0%2C%2C1050%2C1%2C%2C%2C%2C3011%3Aco%3A0%3Acpf%3A1%3Ans%3A1712320905175%3Agi%3AR0ExLjEuMTQ5MzcxMDA3My4xNzEyMzIwOTA4%3Aadb%3A2%3Arqnl%3A1%3Ast%3A1712320910%3At%3A%D0%A0%D0%B5%D1%81%D1%82%D0%BE%D1%80%D0%B0%D0%BD%20%E2%84%9613%20%D0%B2%20%D0%A1%D0%BE%D1%87%D0%B8%20%D0%BD%D0%B0%20%D0%9C%D0%B0%D0%BD%D0%B4%D0%B0%D1%80%D0%B8%D0%BD%D0%B5.%20%D0%90%D0%B2%D1%82%D0%BE%D1%80%D1%81%D0%BA%D0%B0%D1%8F%20%D0%BA%D1%83%D1%85%D0%BD%D1%8F%2C%20%D0%B1%D1%80%D0%BE%D0%BD%D0%B8%D1%80%D0%BE%D0%B2%D0%B0%D0%BD%D0%B8%D0%B5%20%D1%81%D1%82%D0%BE%D0%BB%D0%BE%D0%B2%2C%20%D0%BC%D0%B5%D0%BD%D1%8E%2C%20%D1%86%D0%B5%D0%BD%D1%8B%2C%20%D0%B4%D0%BE%D1%81%D1%82%D0%B0%D0%B2%D0%BA%D0%B0%20%D0%B5%D0%B4%D1%8B%20%7C%20%D0%9E%D1%84%D0%B8%D1%86%D0%B8%D0%B0%D0%BB%D1%8C%D0%BD%D1%8B%D0%B9%20%D1%81%D0%B0%D0%B9%D1%82%20%E2%80%A2%2013&t=gdpr%2814%29clc%280-0-0%29rqnt%281%29eco%2821037572%29aw%281%29rcm%281%29cdl%28na%29ti%281%29

Requested by

Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/

Protocol

Server

2a02:6b8::1:119 , Russian Federation, ASN13238 (YANDEX, RU),

Reverse DNS

Software

Resource Hash

1e1d0e62accbbb68058907091cca9e56aa673f31bc136b24778cb57b2d88b814

Security Headers

Name	Value
Strict-Transport-Security	max-age=31536000
X-Content-Type-Options	nosniff
X-Xss-Protection	1; mode=block

Request headers

accept-language: en-US,en;q=0.9
Referer: https://13.testfamilygarden.su/
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36

Response headers

pragma: no-cache
date: Fri, 05 Apr 2024 12:41:49 GMT
strict-transport-security: max-age=31536000
x-content-type-options: nosniff
last-modified: Fri, 05-Apr-2024 12:41:49 GMT
accept-ch: Sec-CH-UA-Bitness, Sec-CH-UA-Arch, Sec-CH-UA-Full-Version, Sec-CH-UA-Mobile, Sec-CH-UA-Model, Sec-CH-UA-Platform-Version, Sec-CH-UA-Full-Version-List, Sec-CH-UA-Platform, Sec-CH-UA, UA-Bitness, UA-Arch, UA-Full-Version, UA-Mobile, UA-Model, UA-Platform-Version, UA-Platform, UA
content-type: application/json; charset=utf-8
access-control-allow-origin: https://13.testfamilygarden.su
cache-control: private, no-cache, no-store, must-revalidate, max-age=0
access-control-allow-credentials: true
content-length: 454
x-xss-protection: 1; mode=block
expires: Fri, 05-Apr-2024 12:41:49 GMT

Redirect headers

pragma: no-cache
date: Fri, 05 Apr 2024 12:41:49 GMT
strict-transport-security: max-age=31536000
last-modified: Fri, 05-Apr-2024 12:41:49 GMT
accept-ch: Sec-CH-UA-Bitness, Sec-CH-UA-Arch, Sec-CH-UA-Full-Version, Sec-CH-UA-Mobile, Sec-CH-UA-Model, Sec-CH-UA-Platform-Version, Sec-CH-UA-Full-Version-List, Sec-CH-UA-Platform, Sec-CH-UA, UA-Bitness, UA-Arch, UA-Full-Version, UA-Mobile, UA-Model, UA-Platform-Version, UA-Platform, UA
location: /watch/89347546/1?wmode=7&page-url=https%3A%2F%2F13.testfamilygarden.su%2F&charset=utf-8&uah=chu%0A%22Google%20Chrome%22%3Bv%3D%22123%22%2C%22Not%3AA-Brand%22%3Bv%3D%228%22%2C%22Chromium%22%3Bv%3D%22123%22%0Acha%0Ax86%0Achb%0A64%0Achf%0A123.0.6312.105%0Achl%0A%22Google%20Chrome%22%3Bv%3D%22123.0.6312.105%22%2C%22Not%3AA-Brand%22%3Bv%3D%228.0.0.0%22%2C%22Chromium%22%3Bv%3D%22123.0.6312.105%22%0Achm%0A%3F0%0Achp%0AWin32%0Achv%0A10.0.0&browser-info=pv%3A1%3Avf%3A6q5vo8idydw3m5q59jr2ws8gr%3Afu%3A0%3Aen%3Autf-8%3Ala%3Aen-US%3Av%3A1290%3Acn%3A1%3Adp%3A0%3Als%3A1670844702263%3Ahid%3A748472765%3Az%3A-600%3Ai%3A20240405024149%3Aet%3A1712320909%3Ac%3A1%3Arn%3A947008341%3Arqn%3A1%3Au%3A1712320909960520166%3Aw%3A1600x1113%3As%3A800x600x24%3Ask%3A1%3Afp%3A2703%3Awv%3A2%3Ads%3A0%2C345%2C1068%2C2%2C0%2C0%2C%2C1050%2C1%2C%2C%2C%2C3011%3Aco%3A0%3Acpf%3A1%3Ans%3A1712320905175%3Agi%3AR0ExLjEuMTQ5MzcxMDA3My4xNzEyMzIwOTA4%3Aadb%3A2%3Arqnl%3A1%3Ast%3A1712320910%3At%3A%D0%A0%D0%B5%D1%81%D1%82%D0%BE%D1%80%D0%B0%D0%BD%20%E2%84%9613%20%D0%B2%20%D0%A1%D0%BE%D1%87%D0%B8%20%D0%BD%D0%B0%20%D0%9C%D0%B0%D0%BD%D0%B4%D0%B0%D1%80%D0%B8%D0%BD%D0%B5.%20%D0%90%D0%B2%D1%82%D0%BE%D1%80%D1%81%D0%BA%D0%B0%D1%8F%20%D0%BA%D1%83%D1%85%D0%BD%D1%8F%2C%20%D0%B1%D1%80%D0%BE%D0%BD%D0%B8%D1%80%D0%BE%D0%B2%D0%B0%D0%BD%D0%B8%D0%B5%20%D1%81%D1%82%D0%BE%D0%BB%D0%BE%D0%B2%2C%20%D0%BC%D0%B5%D0%BD%D1%8E%2C%20%D1%86%D0%B5%D0%BD%D1%8B%2C%20%D0%B4%D0%BE%D1%81%D1%82%D0%B0%D0%B2%D0%BA%D0%B0%20%D0%B5%D0%B4%D1%8B%20%7C%20%D0%9E%D1%84%D0%B8%D1%86%D0%B8%D0%B0%D0%BB%D1%8C%D0%BD%D1%8B%D0%B9%20%D1%81%D0%B0%D0%B9%D1%82%20%E2%80%A2%2013&t=gdpr%2814%29clc%280-0-0%29rqnt%281%29eco%2821037572%29aw%281%29rcm%281%29cdl%28na%29ti%281%29
access-control-allow-origin: https://13.testfamilygarden.su
cache-control: private, no-cache, no-store, must-revalidate, max-age=0
access-control-allow-credentials: true
x-xss-protection: 1; mode=block
expires: Fri, 05-Apr-2024 12:41:49 GMT

GET
DATA 200
OK truncated
/ 104 B
0 Image
image/png

General

Check archive.org

Show headers Download Go to Show image

Full URL: data:truncated
Protocol: DATA
Server: -, , ASN (),
Reverse DNS
Software: /
Resource Hash: ac301e04134f0a6a5a96b2e9f056107818db1d84226f0cf85d700d196c44ed85

Request headers

accept-language: en-US,en;q=0.9
Referer
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36

Response headers

Content-Type: image/png

GET
DATA 200
OK truncated
/ 2 KB
0 Image
image/svg+xml

General

Check archive.org

Show headers Download Go to Show image

Full URL: data:truncated
Protocol: DATA
Server: -, , ASN (),
Reverse DNS
Software: /
Resource Hash: 9cfeddeac6bec7714f140da244af0823eb469e665411fc571451f889a1d7fa94

Request headers

accept-language: en-US,en;q=0.9
Referer
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36

Response headers

Content-Type: image/svg+xml

GET
DATA 200
OK truncated
/ 315 B
0 Image
image/svg+xml

General

Check archive.org

Show headers Download Go to Show image

Full URL: data:truncated
Protocol: DATA
Server: -, , ASN (),
Reverse DNS
Software: /
Resource Hash: 365e85a31de197b7e074e022301502692aa6f4d56ffca64b505546b986e8ffc0

Request headers

accept-language: en-US,en;q=0.9
Referer
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36

Response headers

Content-Type: image/svg+xml

GET
H2 200 /
yandex.ru/clck/counter/dtype=stred/pid=443/cid=72724/path=2_1_79.mapSize.1600x450.Desktop.2_1_79/rnd=1712320909712/*https://yandex.ru/maps/ 43 B
127 B 705ms
160ms Image
image/gif 2a02:6b8:a::a
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL

https://yandex.ru/clck/counter/dtype=stred/pid=443/cid=72724/path=2_1_79.mapSize.1600x450.Desktop.2_1_79/rnd=1712320909712/*https://yandex.ru/maps/

Requested by

Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/

Protocol

Security

TLS 1.3, , AES_256_GCM

Server

2a02:6b8:a::a , Russian Federation, ASN13238 (YANDEX, RU),

Reverse DNS

Software

Resource Hash

7e928161cd626935d39ff08188caa3f3a918811ca87194082dedf28b697ce6fd

Security Headers

Name	Value
X-Content-Type-Options	nosniff

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

x-content-type-options: nosniff
nel: {"report_to": "network-errors", "max_age": 100, "success_fraction": 0.001, "failure_fraction": 0.1}
accept-ch: Sec-CH-UA-Platform-Version, Sec-CH-UA-Mobile, Sec-CH-UA-Model, Sec-CH-UA, Sec-CH-UA-Full-Version-List, Sec-CH-UA-WoW64, Sec-CH-UA-Arch, Sec-CH-UA-Bitness, Sec-CH-UA-Platform, Sec-CH-UA-Full-Version, Viewport-Width, DPR, Device-Memory, RTT, Downlink, ECT
x-yandex-req-id: 1712320910290338-5373604420541761851-balancer-l7leveler-kubr-yp-vla-103-BAL
report-to: { "group": "network-errors", "max_age": 100, "endpoints": [{"url": "https://dr.yandex.net/nel", "priority": 1}, {"url": "https://dr2.yandex.net/nel", "priority": 2}]}
content-type: image/gif
cache-control: no-cache
content-length: 43

GET
H2 200 /
yandex.ru/clck/counter/dtype=stred/pid=443/cid=72724/path=2_1_79.mapDpr.1.Desktop.2_1_79/rnd=1712320909667/*https://yandex.ru/maps/ 43 B
127 B 702ms
158ms Image
image/gif 2a02:6b8:a::a
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL

https://yandex.ru/clck/counter/dtype=stred/pid=443/cid=72724/path=2_1_79.mapDpr.1.Desktop.2_1_79/rnd=1712320909667/*https://yandex.ru/maps/

Requested by

Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/

Protocol

Security

TLS 1.3, , AES_256_GCM

Server

2a02:6b8:a::a , Russian Federation, ASN13238 (YANDEX, RU),

Reverse DNS

Software

Resource Hash

7e928161cd626935d39ff08188caa3f3a918811ca87194082dedf28b697ce6fd

Security Headers

Name	Value
X-Content-Type-Options	nosniff

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

x-content-type-options: nosniff
nel: {"report_to": "network-errors", "max_age": 100, "success_fraction": 0.001, "failure_fraction": 0.1}
accept-ch: Sec-CH-UA-Platform-Version, Sec-CH-UA-Mobile, Sec-CH-UA-Model, Sec-CH-UA, Sec-CH-UA-Full-Version-List, Sec-CH-UA-WoW64, Sec-CH-UA-Arch, Sec-CH-UA-Bitness, Sec-CH-UA-Platform, Sec-CH-UA-Full-Version, Viewport-Width, DPR, Device-Memory, RTT, Downlink, ECT
x-yandex-req-id: 1712320910291839-2857406426752360298-balancer-l7leveler-kubr-yp-vla-103-BAL
report-to: { "group": "network-errors", "max_age": 100, "endpoints": [{"url": "https://dr.yandex.net/nel", "priority": 1}, {"url": "https://dr2.yandex.net/nel", "priority": 2}]}
content-type: image/gif
cache-control: no-cache
content-length: 43

GET
H2 200 /
yandex.ru/clck/counter/dtype=stred/pid=443/cid=72724/path=2_1_79.inception.map/rnd=1712320909720/*https://yandex.ru/maps/ 43 B
247 B 694ms
151ms Image
image/gif 2a02:6b8:a::a
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL

https://yandex.ru/clck/counter/dtype=stred/pid=443/cid=72724/path=2_1_79.inception.map/rnd=1712320909720/*https://yandex.ru/maps/

Requested by

Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/

Protocol

Security

TLS 1.3, , AES_256_GCM

Server

2a02:6b8:a::a , Russian Federation, ASN13238 (YANDEX, RU),

Reverse DNS

Software

Resource Hash

7e928161cd626935d39ff08188caa3f3a918811ca87194082dedf28b697ce6fd

Security Headers

Name	Value
X-Content-Type-Options	nosniff

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

x-content-type-options: nosniff
nel: {"report_to": "network-errors", "max_age": 100, "success_fraction": 0.001, "failure_fraction": 0.1}
accept-ch: Sec-CH-UA-Platform-Version, Sec-CH-UA-Mobile, Sec-CH-UA-Model, Sec-CH-UA, Sec-CH-UA-Full-Version-List, Sec-CH-UA-WoW64, Sec-CH-UA-Arch, Sec-CH-UA-Bitness, Sec-CH-UA-Platform, Sec-CH-UA-Full-Version, Viewport-Width, DPR, Device-Memory, RTT, Downlink, ECT
x-yandex-req-id: 1712320910290626-16822505666984236647-balancer-l7leveler-kubr-yp-vla-103-BAL
report-to: { "group": "network-errors", "max_age": 100, "endpoints": [{"url": "https://dr.yandex.net/nel", "priority": 1}, {"url": "https://dr2.yandex.net/nel", "priority": 2}]}
content-type: image/gif
cache-control: no-cache
content-length: 43

GET
H2 200 /
yandex.ru/clck/counter/dtype=stred/pid=443/cid=72717/path=created.2_1_79.Desktop/rnd=1712320909697/*https://yandex.ru/maps/ 43 B
129 B 693ms
150ms Image
image/gif 2a02:6b8:a::a
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL

https://yandex.ru/clck/counter/dtype=stred/pid=443/cid=72717/path=created.2_1_79.Desktop/rnd=1712320909697/*https://yandex.ru/maps/

Requested by

Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/

Protocol

Security

TLS 1.3, , AES_256_GCM

Server

2a02:6b8:a::a , Russian Federation, ASN13238 (YANDEX, RU),

Reverse DNS

Software

Resource Hash

7e928161cd626935d39ff08188caa3f3a918811ca87194082dedf28b697ce6fd

Security Headers

Name	Value
X-Content-Type-Options	nosniff

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

x-content-type-options: nosniff
nel: {"report_to": "network-errors", "max_age": 100, "success_fraction": 0.001, "failure_fraction": 0.1}
accept-ch: Sec-CH-UA-Platform-Version, Sec-CH-UA-Mobile, Sec-CH-UA-Model, Sec-CH-UA, Sec-CH-UA-Full-Version-List, Sec-CH-UA-WoW64, Sec-CH-UA-Arch, Sec-CH-UA-Bitness, Sec-CH-UA-Platform, Sec-CH-UA-Full-Version, Viewport-Width, DPR, Device-Memory, RTT, Downlink, ECT
x-yandex-req-id: 1712320910291507-10455569002674992367-balancer-l7leveler-kubr-yp-vla-103-BAL
report-to: { "group": "network-errors", "max_age": 100, "endpoints": [{"url": "https://dr.yandex.net/nel", "priority": 1}, {"url": "https://dr2.yandex.net/nel", "priority": 2}]}
content-type: image/gif
cache-control: no-cache
content-length: 43

GET
H2 200 /
yandex.ru/clck/counter/dtype=stred/pid=443/cid=72961/path=2_1_79.vectorEngine.reasonsVectorNotSupported.hasWebGl.Desktop.Chrome../rnd=1712320909726/*https://yandex.ru/maps/ 43 B
128 B 703ms
159ms Image
image/gif 2a02:6b8:a::a
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL

https://yandex.ru/clck/counter/dtype=stred/pid=443/cid=72961/path=2_1_79.vectorEngine.reasonsVectorNotSupported.hasWebGl.Desktop.Chrome../rnd=1712320909726/*https://yandex.ru/maps/

Requested by

Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/

Protocol

Security

TLS 1.3, , AES_256_GCM

Server

2a02:6b8:a::a , Russian Federation, ASN13238 (YANDEX, RU),

Reverse DNS

Software

Resource Hash

7e928161cd626935d39ff08188caa3f3a918811ca87194082dedf28b697ce6fd

Security Headers

Name	Value
X-Content-Type-Options	nosniff

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

x-content-type-options: nosniff
nel: {"report_to": "network-errors", "max_age": 100, "success_fraction": 0.001, "failure_fraction": 0.1}
accept-ch: Sec-CH-UA-Platform-Version, Sec-CH-UA-Mobile, Sec-CH-UA-Model, Sec-CH-UA, Sec-CH-UA-Full-Version-List, Sec-CH-UA-WoW64, Sec-CH-UA-Arch, Sec-CH-UA-Bitness, Sec-CH-UA-Platform, Sec-CH-UA-Full-Version, Viewport-Width, DPR, Device-Memory, RTT, Downlink, ECT
x-yandex-req-id: 1712320910289807-7986876144691804985-balancer-l7leveler-kubr-yp-vla-103-BAL
report-to: { "group": "network-errors", "max_age": 100, "endpoints": [{"url": "https://dr.yandex.net/nel", "priority": 1}, {"url": "https://dr2.yandex.net/nel", "priority": 2}]}
content-type: image/gif
cache-control: no-cache
content-length: 43

GET
H2 200 /
yandex.ru/clck/counter/dtype=stred/pid=443/cid=72961/path=2_1_79.vectorEngine.vectorNotSupported.Desktop.Chrome/rnd=1712320909746/*https://yandex.ru/maps/ 43 B
900 B 690ms
148ms Image
image/gif 2a02:6b8:a::a
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL

https://yandex.ru/clck/counter/dtype=stred/pid=443/cid=72961/path=2_1_79.vectorEngine.vectorNotSupported.Desktop.Chrome/rnd=1712320909746/*https://yandex.ru/maps/

Requested by

Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/

Protocol

Security

TLS 1.3, , AES_256_GCM

Server

2a02:6b8:a::a , Russian Federation, ASN13238 (YANDEX, RU),

Reverse DNS

Software

Resource Hash

7e928161cd626935d39ff08188caa3f3a918811ca87194082dedf28b697ce6fd

Security Headers

Name	Value
X-Content-Type-Options	nosniff

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

x-content-type-options: nosniff
nel: {"report_to": "network-errors", "max_age": 100, "success_fraction": 0.001, "failure_fraction": 0.1}
accept-ch: Sec-CH-UA-Platform-Version, Sec-CH-UA-Mobile, Sec-CH-UA-Model, Sec-CH-UA, Sec-CH-UA-Full-Version-List, Sec-CH-UA-WoW64, Sec-CH-UA-Arch, Sec-CH-UA-Bitness, Sec-CH-UA-Platform, Sec-CH-UA-Full-Version, Viewport-Width, DPR, Device-Memory, RTT, Downlink, ECT
x-yandex-req-id: 1712320910291086-16394665994738676854-balancer-l7leveler-kubr-yp-vla-103-BAL
report-to: { "group": "network-errors", "max_age": 100, "endpoints": [{"url": "https://dr.yandex.net/nel", "priority": 1}, {"url": "https://dr2.yandex.net/nel", "priority": 2}]}
content-type: image/gif
cache-control: no-cache
content-length: 43

GET
H2 200 tiles
core-renderer-tiles.maps.yandex.net/ 1 KB
1 KB 547ms
168ms Image
image/png 2a02:6b8::2b8
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://core-renderer-tiles.maps.yandex.net/tiles?l=map&v=24.04.05-1&x=1251&y=751&z=11&scale=1&lang=ru_RU&experimental_dataprestable=1&apikey=596f8653-37a9-4aca-9e49-73d83164925f&ads=enabled
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a02:6b8::2b8 , Russian Federation, ASN13238 (YANDEX, RU),
Reverse DNS
Software: /
Resource Hash: cab3833629733b6af3fbed5684a129c04be090f60f5c52e46a93487a0684e20d

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

access-control-allow-origin: *
date: Fri, 05 Apr 2024 12:41:50 GMT
cache-control: max-age=7654321
x-l7-hostname: wipwoxb5o6v32mv7.vla.yp-c.yandex.net
content-length: 1232
etag: "1339dae5e4e5869f202cc9002dca9654"
content-type: image/png

GET
H2 200 tiles
core-renderer-tiles.maps.yandex.net/ 159 B
333 B 562ms
187ms Image
image/png 2a02:6b8::2b8
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://core-renderer-tiles.maps.yandex.net/tiles?l=map&v=24.04.05-1&x=1250&y=751&z=11&scale=1&lang=ru_RU&experimental_dataprestable=1&apikey=596f8653-37a9-4aca-9e49-73d83164925f&ads=enabled
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a02:6b8::2b8 , Russian Federation, ASN13238 (YANDEX, RU),
Reverse DNS
Software: /
Resource Hash: 6ba4f30215462f931c413a6dbf074eadb33f6b1f6024383ec466a394597ca137

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

access-control-allow-origin: *
date: Fri, 05 Apr 2024 12:41:50 GMT
cache-control: max-age=7654321
x-l7-hostname: zdzc3g7sh6qscded.klg.yp-c.yandex.net
content-length: 159
etag: "50d413299e6d280bb3b127c5b44ba049"
content-type: image/png

GET
H2 200 tiles
core-renderer-tiles.maps.yandex.net/ 12 KB
12 KB 687ms
312ms Image
image/png 2a02:6b8::2b8
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://core-renderer-tiles.maps.yandex.net/tiles?l=map&v=24.04.05-1&x=1252&y=751&z=11&scale=1&lang=ru_RU&experimental_dataprestable=1&apikey=596f8653-37a9-4aca-9e49-73d83164925f&ads=enabled
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a02:6b8::2b8 , Russian Federation, ASN13238 (YANDEX, RU),
Reverse DNS
Software: /
Resource Hash: 28895789dd3be561ad371c1e6b510929c55462b646b0b7fb45486fe7d0679f4f

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

access-control-allow-origin: *
date: Fri, 05 Apr 2024 12:41:50 GMT
cache-control: max-age=7654321
x-l7-hostname: ytsxekc47gpkvd4r.klg.yp-c.yandex.net
content-length: 12108
etag: "0dbc4a10d05174464358045ac952bd17"
content-type: image/png

GET
H2 200 / Show response
api-maps.yandex.ru/services/coverage/v2/ 235 B
521 B 175ms
175ms Script
text/javascript 2a02:6b8::274
YANDEX

General

Check archive.org

Show headers Download Go to

Full URL

https://api-maps.yandex.ru/services/coverage/v2/?l=map&ll=39.92280158,43.41858381&z=11&lang=ru_RU&experimental_dataprestable=1&callback=jsonp_yandex_coverage__l_map_ll_39_92280158_43_41858381_z_11_lang_ru_RU_experimental_dataprestable_1

Requested by

Host: yastatic.net
URL: https://yastatic.net/s3/front-maps-static/maps-front-jsapi-v2-1/2.1.79-13725638/build/release/full-f7815554a5a1454cb96dbe8680afeb6e7a6e1cb5.js

Protocol

Security

TLS 1.3, , AES_256_GCM

Server

2a02:6b8::274 , Russian Federation, ASN13238 (YANDEX, RU),

Reverse DNS

Software

Resource Hash

a4e025e2f423531ef488606ff5bf0c937fa71d6c7250bee0801d1efd32cad97e

Security Headers

Name	Value
X-Content-Type-Options	nosniff, nosniff
X-Xss-Protection	1; mode=block

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

expires: Sat, 06 Apr 2024 12:41:49 GMT
date: Fri, 05 Apr 2024 12:41:49 GMT
x-content-type-options: nosniff, nosniff
etag: W/"eb-8nHGD7gdiVHsgX+nbO09M3mDQ24"
content-type: text/javascript; charset=utf-8
x-req-id: 1712320909761148-2473138442314139984-jh66c5t2ncewkhw5-BAL
content-length: 235
x-xss-protection: 1; mode=block
x-start-time: 1712320909761148

GET
H2 200 tiles
core-renderer-tiles.maps.yandex.net/ 159 B
472 B 538ms
167ms Image
image/png 2a02:6b8::2b8
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://core-renderer-tiles.maps.yandex.net/tiles?l=map&v=24.04.05-1&x=1249&y=751&z=11&scale=1&lang=ru_RU&experimental_dataprestable=1&apikey=596f8653-37a9-4aca-9e49-73d83164925f&ads=enabled
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a02:6b8::2b8 , Russian Federation, ASN13238 (YANDEX, RU),
Reverse DNS
Software: /
Resource Hash: 6ba4f30215462f931c413a6dbf074eadb33f6b1f6024383ec466a394597ca137

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

access-control-allow-origin: *
date: Fri, 05 Apr 2024 12:41:50 GMT
cache-control: max-age=7654321
x-l7-hostname: snvpc5cdsgtqxe2i.sas.yp-c.yandex.net
content-length: 159
etag: "50d413299e6d280bb3b127c5b44ba049"
content-type: image/png

GET
H2 200 tiles
core-renderer-tiles.maps.yandex.net/ 26 KB
26 KB 361ms
359ms Image
image/png 2a02:6b8::2b8
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://core-renderer-tiles.maps.yandex.net/tiles?l=map&v=24.04.05-1&x=1253&y=751&z=11&scale=1&lang=ru_RU&experimental_dataprestable=1&apikey=596f8653-37a9-4aca-9e49-73d83164925f&ads=enabled
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a02:6b8::2b8 , Russian Federation, ASN13238 (YANDEX, RU),
Reverse DNS
Software: /
Resource Hash: 4766221a7705ecc4bb03f528f54f9ed1546b87e8d0caf409e2c1edc692b11de3

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

access-control-allow-origin: *
date: Fri, 05 Apr 2024 12:41:50 GMT
cache-control: max-age=7654321
x-l7-hostname: xwpwmdevqs42yasr.klg.yp-c.yandex.net
content-length: 26229
etag: "90256f661ffb40b79cf2d6318232635f"
content-type: image/png

GET
H2 200 tiles
core-renderer-tiles.maps.yandex.net/ 159 B
327 B 240ms
238ms Image
image/png 2a02:6b8::2b8
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://core-renderer-tiles.maps.yandex.net/tiles?l=map&v=24.04.05-1&x=1249&y=750&z=11&scale=1&lang=ru_RU&experimental_dataprestable=1&apikey=596f8653-37a9-4aca-9e49-73d83164925f&ads=enabled
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a02:6b8::2b8 , Russian Federation, ASN13238 (YANDEX, RU),
Reverse DNS
Software: /
Resource Hash: 6ba4f30215462f931c413a6dbf074eadb33f6b1f6024383ec466a394597ca137

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

access-control-allow-origin: *
date: Fri, 05 Apr 2024 12:41:50 GMT
cache-control: max-age=7654321
x-l7-hostname: k5bvqe7etzlzsnzi.vla.yp-c.yandex.net
content-length: 159
etag: "50d413299e6d280bb3b127c5b44ba049"
content-type: image/png

GET
H2 200 tiles
core-renderer-tiles.maps.yandex.net/ 159 B
298 B 241ms
239ms Image
image/png 2a02:6b8::2b8
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://core-renderer-tiles.maps.yandex.net/tiles?l=map&v=24.04.05-1&x=1249&y=752&z=11&scale=1&lang=ru_RU&experimental_dataprestable=1&apikey=596f8653-37a9-4aca-9e49-73d83164925f&ads=enabled
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a02:6b8::2b8 , Russian Federation, ASN13238 (YANDEX, RU),
Reverse DNS
Software: /
Resource Hash: 6ba4f30215462f931c413a6dbf074eadb33f6b1f6024383ec466a394597ca137

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

access-control-allow-origin: *
date: Fri, 05 Apr 2024 12:41:50 GMT
cache-control: max-age=7654321
x-l7-hostname: wipwoxb5o6v32mv7.vla.yp-c.yandex.net
content-length: 159
etag: "50d413299e6d280bb3b127c5b44ba049"
content-type: image/png

GET
H2 200 tiles
core-renderer-tiles.maps.yandex.net/ 4 KB
4 KB 242ms
240ms Image
image/png 2a02:6b8::2b8
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://core-renderer-tiles.maps.yandex.net/tiles?l=map&v=24.04.05-1&x=1250&y=750&z=11&scale=1&lang=ru_RU&experimental_dataprestable=1&apikey=596f8653-37a9-4aca-9e49-73d83164925f&ads=enabled
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a02:6b8::2b8 , Russian Federation, ASN13238 (YANDEX, RU),
Reverse DNS
Software: /
Resource Hash: ddca6f1dfe3f2f8f62a2f748cafee82865735149a4ff4d586da02053791b3886

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

access-control-allow-origin: *
date: Fri, 05 Apr 2024 12:41:50 GMT
cache-control: max-age=7654321
x-l7-hostname: smofz2kh4nepstij.vla.yp-c.yandex.net
content-length: 3962
etag: "838b5dcd1e1c170ef6bf5998d8c911ab"
content-type: image/png

GET
H2 200 tiles
core-renderer-tiles.maps.yandex.net/ 159 B
247 B 570ms
568ms Image
image/png 2a02:6b8::2b8
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://core-renderer-tiles.maps.yandex.net/tiles?l=map&v=24.04.05-1&x=1250&y=752&z=11&scale=1&lang=ru_RU&experimental_dataprestable=1&apikey=596f8653-37a9-4aca-9e49-73d83164925f&ads=enabled
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a02:6b8::2b8 , Russian Federation, ASN13238 (YANDEX, RU),
Reverse DNS
Software: /
Resource Hash: 6ba4f30215462f931c413a6dbf074eadb33f6b1f6024383ec466a394597ca137

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

access-control-allow-origin: *
date: Fri, 05 Apr 2024 12:41:50 GMT
cache-control: max-age=7654321
x-l7-hostname: muzck46xgw7kuq4z.vla.yp-c.yandex.net
content-length: 159
etag: "50d413299e6d280bb3b127c5b44ba049"
content-type: image/png

GET
H2 200 tiles
core-renderer-tiles.maps.yandex.net/ 25 KB
25 KB 507ms
505ms Image
image/png 2a02:6b8::2b8
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://core-renderer-tiles.maps.yandex.net/tiles?l=map&v=24.04.05-1&x=1251&y=750&z=11&scale=1&lang=ru_RU&experimental_dataprestable=1&apikey=596f8653-37a9-4aca-9e49-73d83164925f&ads=enabled
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a02:6b8::2b8 , Russian Federation, ASN13238 (YANDEX, RU),
Reverse DNS
Software: /
Resource Hash: d5b46696fd491539a2d8bb8be0dbba12b2eafc44722d3ab0868b2db51130ed81

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

access-control-allow-origin: *
date: Fri, 05 Apr 2024 12:41:50 GMT
cache-control: max-age=7654321
x-l7-hostname: hnmichlurwanrllh.vla.yp-c.yandex.net
content-length: 25776
etag: "1398ad617314088de75d7974e0394e58"
content-type: image/png

GET
H2 200 tiles
core-renderer-tiles.maps.yandex.net/ 159 B
328 B 531ms
530ms Image
image/png 2a02:6b8::2b8
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://core-renderer-tiles.maps.yandex.net/tiles?l=map&v=24.04.05-1&x=1251&y=752&z=11&scale=1&lang=ru_RU&experimental_dataprestable=1&apikey=596f8653-37a9-4aca-9e49-73d83164925f&ads=enabled
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a02:6b8::2b8 , Russian Federation, ASN13238 (YANDEX, RU),
Reverse DNS
Software: /
Resource Hash: 6ba4f30215462f931c413a6dbf074eadb33f6b1f6024383ec466a394597ca137

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

access-control-allow-origin: *
date: Fri, 05 Apr 2024 12:41:50 GMT
cache-control: max-age=7654321
x-l7-hostname: vcbrlgv2tj7bwfik.vla.yp-c.yandex.net
content-length: 159
etag: "50d413299e6d280bb3b127c5b44ba049"
content-type: image/png

GET
H2 200 tiles
core-renderer-tiles.maps.yandex.net/ 26 KB
26 KB 424ms
423ms Image
image/png 2a02:6b8::2b8
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://core-renderer-tiles.maps.yandex.net/tiles?l=map&v=24.04.05-1&x=1252&y=750&z=11&scale=1&lang=ru_RU&experimental_dataprestable=1&apikey=596f8653-37a9-4aca-9e49-73d83164925f&ads=enabled
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a02:6b8::2b8 , Russian Federation, ASN13238 (YANDEX, RU),
Reverse DNS
Software: /
Resource Hash: b24d9843229433cbbe357914a99a3023a8e2c1048f97e1322920c4f803974e73

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

access-control-allow-origin: *
date: Fri, 05 Apr 2024 12:41:50 GMT
cache-control: max-age=7654321
x-l7-hostname: zdzc3g7sh6qscded.klg.yp-c.yandex.net
content-length: 26881
etag: "54eb568afcab96263aa57d719ccf1fd5"
content-type: image/png

GET
H2 200 tiles
core-renderer-tiles.maps.yandex.net/ 159 B
304 B 425ms
424ms Image
image/png 2a02:6b8::2b8
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://core-renderer-tiles.maps.yandex.net/tiles?l=map&v=24.04.05-1&x=1252&y=752&z=11&scale=1&lang=ru_RU&experimental_dataprestable=1&apikey=596f8653-37a9-4aca-9e49-73d83164925f&ads=enabled
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a02:6b8::2b8 , Russian Federation, ASN13238 (YANDEX, RU),
Reverse DNS
Software: /
Resource Hash: 6ba4f30215462f931c413a6dbf074eadb33f6b1f6024383ec466a394597ca137

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

access-control-allow-origin: *
date: Fri, 05 Apr 2024 12:41:50 GMT
cache-control: max-age=7654321
x-l7-hostname: xwpwmdevqs42yasr.klg.yp-c.yandex.net
content-length: 159
etag: "50d413299e6d280bb3b127c5b44ba049"
content-type: image/png

GET
H2 200 tiles
core-renderer-tiles.maps.yandex.net/ 26 KB
27 KB 532ms
531ms Image
image/png 2a02:6b8::2b8
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://core-renderer-tiles.maps.yandex.net/tiles?l=map&v=24.04.05-1&x=1253&y=750&z=11&scale=1&lang=ru_RU&experimental_dataprestable=1&apikey=596f8653-37a9-4aca-9e49-73d83164925f&ads=enabled
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a02:6b8::2b8 , Russian Federation, ASN13238 (YANDEX, RU),
Reverse DNS
Software: /
Resource Hash: e144ef832340a28c93109458a08d4d5bcae01107a0a24bca8a8b20aa7dced402

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

access-control-allow-origin: *
date: Fri, 05 Apr 2024 12:41:50 GMT
cache-control: max-age=7654321
x-l7-hostname: kj6gx2gw76wcg4ah.vla.yp-c.yandex.net
content-length: 27089
etag: "e9b6104209c54217cdc2b3203571b96d"
content-type: image/png

GET
H2 200 tiles
core-renderer-tiles.maps.yandex.net/ 19 KB
19 KB 530ms
529ms Image
image/png 2a02:6b8::2b8
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://core-renderer-tiles.maps.yandex.net/tiles?l=map&v=24.04.05-1&x=1253&y=752&z=11&scale=1&lang=ru_RU&experimental_dataprestable=1&apikey=596f8653-37a9-4aca-9e49-73d83164925f&ads=enabled
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a02:6b8::2b8 , Russian Federation, ASN13238 (YANDEX, RU),
Reverse DNS
Software: /
Resource Hash: 34e3661b7feb102836d058d5745d46d856b2891a8aafab0a1f34c3426b634adb

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

access-control-allow-origin: *
date: Fri, 05 Apr 2024 12:41:50 GMT
cache-control: max-age=7654321
x-l7-hostname: so5dvhktpe3rhdh2.vla.yp-c.yandex.net
content-length: 19736
etag: "85f2bdebe3b95f94cd7d6f63944d5ed5"
content-type: image/png

GET
H2 200 tiles
core-renderer-tiles.maps.yandex.net/ 159 B
332 B 531ms
529ms Image
image/png 2a02:6b8::2b8
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://core-renderer-tiles.maps.yandex.net/tiles?l=map&v=24.04.05-1&x=1248&y=750&z=11&scale=1&lang=ru_RU&experimental_dataprestable=1&apikey=596f8653-37a9-4aca-9e49-73d83164925f&ads=enabled
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a02:6b8::2b8 , Russian Federation, ASN13238 (YANDEX, RU),
Reverse DNS
Software: /
Resource Hash: 6ba4f30215462f931c413a6dbf074eadb33f6b1f6024383ec466a394597ca137

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

access-control-allow-origin: *
date: Fri, 05 Apr 2024 12:41:50 GMT
cache-control: max-age=7654321
x-l7-hostname: cpx35ncjxvujbd7e.sas.yp-c.yandex.net
content-length: 159
etag: "50d413299e6d280bb3b127c5b44ba049"
content-type: image/png

GET
H2 200 13.png
13.testfamilygarden.su/upload/img/ 15 KB
15 KB 1322ms
1322ms Image
image/png 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/img/13.png
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: e30838a26f849ab332e679e9067ee336a3692f3b5c5e9c5d11b4497fca287097

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:49 GMT
last-modified: Wed, 13 Mar 2024 12:39:11 GMT
server: nginx
etag: "65f19e6f-3cd3"
content-type: image/png
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 15571
expires: Mon, 20 May 2024 12:41:49 GMT

GET
DATA 200
OK truncated
/ 289 B
0 Image
image/svg+xml

General

Check archive.org

Show headers Download Go to Show image

Full URL: data:truncated
Protocol: DATA
Server: -, , ASN (),
Reverse DNS
Software: /
Resource Hash: cecb43d9abbe069f2bd526b5ba0d2a0cc61c63171f4d5880fdca4e23171412cc

Request headers

accept-language: en-US,en;q=0.9
Referer
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36

Response headers

Content-Type: image/svg+xml

GET
H2 200 tiles
core-renderer-tiles.maps.yandex.net/ 159 B
215 B 621ms
620ms Image
image/png 2a02:6b8::2b8
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://core-renderer-tiles.maps.yandex.net/tiles?l=map&v=24.04.05-1&x=1248&y=751&z=11&scale=1&lang=ru_RU&experimental_dataprestable=1&apikey=596f8653-37a9-4aca-9e49-73d83164925f&ads=enabled
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a02:6b8::2b8 , Russian Federation, ASN13238 (YANDEX, RU),
Reverse DNS
Software: /
Resource Hash: 6ba4f30215462f931c413a6dbf074eadb33f6b1f6024383ec466a394597ca137

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

access-control-allow-origin: *
date: Fri, 05 Apr 2024 12:41:50 GMT
cache-control: max-age=7654321
x-l7-hostname: hu4jiz6zjijn434w.vla.yp-c.yandex.net
content-length: 159
etag: "50d413299e6d280bb3b127c5b44ba049"
content-type: image/png

GET
H2 200 tiles
core-renderer-tiles.maps.yandex.net/ 159 B
304 B 435ms
435ms Image
image/png 2a02:6b8::2b8
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://core-renderer-tiles.maps.yandex.net/tiles?l=map&v=24.04.05-1&x=1248&y=752&z=11&scale=1&lang=ru_RU&experimental_dataprestable=1&apikey=596f8653-37a9-4aca-9e49-73d83164925f&ads=enabled
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a02:6b8::2b8 , Russian Federation, ASN13238 (YANDEX, RU),
Reverse DNS
Software: /
Resource Hash: 6ba4f30215462f931c413a6dbf074eadb33f6b1f6024383ec466a394597ca137

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

access-control-allow-origin: *
date: Fri, 05 Apr 2024 12:41:50 GMT
cache-control: max-age=7654321
x-l7-hostname: k5bvqe7etzlzsnzi.vla.yp-c.yandex.net
content-length: 159
etag: "50d413299e6d280bb3b127c5b44ba049"
content-type: image/png

GET
H2 200 tiles
core-renderer-tiles.maps.yandex.net/ 28 KB
28 KB 436ms
435ms Image
image/png 2a02:6b8::2b8
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://core-renderer-tiles.maps.yandex.net/tiles?l=map&v=24.04.05-1&x=1254&y=750&z=11&scale=1&lang=ru_RU&experimental_dataprestable=1&apikey=596f8653-37a9-4aca-9e49-73d83164925f&ads=enabled
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a02:6b8::2b8 , Russian Federation, ASN13238 (YANDEX, RU),
Reverse DNS
Software: /
Resource Hash: 78351d19380118045a0512733bf54e656d4f964303d30b71ef7c7588706789c4

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

access-control-allow-origin: *
date: Fri, 05 Apr 2024 12:41:50 GMT
cache-control: max-age=7654321
x-l7-hostname: zsytis6vdjm5j3px.sas.yp-c.yandex.net
content-length: 28395
etag: "2602faf12875d6cc2e5fdedfaf274380"
content-type: image/png

GET
H2 200 tiles
core-renderer-tiles.maps.yandex.net/ 25 KB
25 KB 512ms
511ms Image
image/png 2a02:6b8::2b8
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://core-renderer-tiles.maps.yandex.net/tiles?l=map&v=24.04.05-1&x=1254&y=751&z=11&scale=1&lang=ru_RU&experimental_dataprestable=1&apikey=596f8653-37a9-4aca-9e49-73d83164925f&ads=enabled
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a02:6b8::2b8 , Russian Federation, ASN13238 (YANDEX, RU),
Reverse DNS
Software: /
Resource Hash: 4e7b6fc8432a41fd57078d09bd47145a8a429b16f2ef77a24a57f482b08d20af

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

access-control-allow-origin: *
date: Fri, 05 Apr 2024 12:41:50 GMT
cache-control: max-age=7654321
x-l7-hostname: yokonrwm77ogudjv.sas.yp-c.yandex.net
content-length: 25757
etag: "5fc7ececde7e60242372a581caef262a"
content-type: image/png

GET
H2 200 tiles
core-renderer-tiles.maps.yandex.net/ 27 KB
27 KB 509ms
509ms Image
image/png 2a02:6b8::2b8
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://core-renderer-tiles.maps.yandex.net/tiles?l=map&v=24.04.05-1&x=1254&y=752&z=11&scale=1&lang=ru_RU&experimental_dataprestable=1&apikey=596f8653-37a9-4aca-9e49-73d83164925f&ads=enabled
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a02:6b8::2b8 , Russian Federation, ASN13238 (YANDEX, RU),
Reverse DNS
Software: /
Resource Hash: d424d25ea64c0d546228debdef031e43d939d8e835b3fc0f32eba929ff1b2e31

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

access-control-allow-origin: *
date: Fri, 05 Apr 2024 12:41:50 GMT
cache-control: max-age=7654321
x-l7-hostname: qwaznttxt3x5uuzm.vla.yp-c.yandex.net
content-length: 27757
etag: "933a1b9646b7653aac8ad8c3428c1d39"
content-type: image/png

GET
H2 200 tiles
core-renderer-tiles.maps.yandex.net/ 159 B
329 B 498ms
497ms Image
image/png 2a02:6b8::2b8
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://core-renderer-tiles.maps.yandex.net/tiles?l=map&v=24.04.05-1&x=1247&y=750&z=11&scale=1&lang=ru_RU&experimental_dataprestable=1&apikey=596f8653-37a9-4aca-9e49-73d83164925f&ads=enabled
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a02:6b8::2b8 , Russian Federation, ASN13238 (YANDEX, RU),
Reverse DNS
Software: /
Resource Hash: 6ba4f30215462f931c413a6dbf074eadb33f6b1f6024383ec466a394597ca137

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

access-control-allow-origin: *
date: Fri, 05 Apr 2024 12:41:50 GMT
cache-control: max-age=7654321
x-l7-hostname: ihjwblyypxqzxxfg.sas.yp-c.yandex.net
content-length: 159
etag: "50d413299e6d280bb3b127c5b44ba049"
content-type: image/png

GET
H2 200 tiles
core-renderer-tiles.maps.yandex.net/ 159 B
185 B 501ms
501ms Image
image/png 2a02:6b8::2b8
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://core-renderer-tiles.maps.yandex.net/tiles?l=map&v=24.04.05-1&x=1247&y=751&z=11&scale=1&lang=ru_RU&experimental_dataprestable=1&apikey=596f8653-37a9-4aca-9e49-73d83164925f&ads=enabled
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a02:6b8::2b8 , Russian Federation, ASN13238 (YANDEX, RU),
Reverse DNS
Software: /
Resource Hash: 6ba4f30215462f931c413a6dbf074eadb33f6b1f6024383ec466a394597ca137

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

access-control-allow-origin: *
date: Fri, 05 Apr 2024 12:41:50 GMT
cache-control: max-age=7654321
x-l7-hostname: ihjwblyypxqzxxfg.sas.yp-c.yandex.net
content-length: 159
etag: "50d413299e6d280bb3b127c5b44ba049"
content-type: image/png

GET
H2 200 tiles
core-renderer-tiles.maps.yandex.net/ 159 B
334 B 372ms
371ms Image
image/png 2a02:6b8::2b8
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://core-renderer-tiles.maps.yandex.net/tiles?l=map&v=24.04.05-1&x=1247&y=752&z=11&scale=1&lang=ru_RU&experimental_dataprestable=1&apikey=596f8653-37a9-4aca-9e49-73d83164925f&ads=enabled
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a02:6b8::2b8 , Russian Federation, ASN13238 (YANDEX, RU),
Reverse DNS
Software: /
Resource Hash: 6ba4f30215462f931c413a6dbf074eadb33f6b1f6024383ec466a394597ca137

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

access-control-allow-origin: *
date: Fri, 05 Apr 2024 12:41:50 GMT
cache-control: max-age=7654321
x-l7-hostname: kena55txumczfl3t.klg.yp-c.yandex.net
content-length: 159
etag: "50d413299e6d280bb3b127c5b44ba049"
content-type: image/png

GET
H2 200 tiles
core-renderer-tiles.maps.yandex.net/ 159 B
332 B 329ms
328ms Image
image/png 2a02:6b8::2b8
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://core-renderer-tiles.maps.yandex.net/tiles?l=map&v=24.04.05-1&x=1247&y=749&z=11&scale=1&lang=ru_RU&experimental_dataprestable=1&apikey=596f8653-37a9-4aca-9e49-73d83164925f&ads=enabled
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a02:6b8::2b8 , Russian Federation, ASN13238 (YANDEX, RU),
Reverse DNS
Software: /
Resource Hash: 6ba4f30215462f931c413a6dbf074eadb33f6b1f6024383ec466a394597ca137

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

access-control-allow-origin: *
date: Fri, 05 Apr 2024 12:41:50 GMT
cache-control: max-age=7654321
x-l7-hostname: qsx5qpyub6rhlsij.vla.yp-c.yandex.net
content-length: 159
etag: "50d413299e6d280bb3b127c5b44ba049"
content-type: image/png

GET
H2 200 tiles
core-renderer-tiles.maps.yandex.net/ 159 B
332 B 330ms
329ms Image
image/png 2a02:6b8::2b8
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://core-renderer-tiles.maps.yandex.net/tiles?l=map&v=24.04.05-1&x=1248&y=749&z=11&scale=1&lang=ru_RU&experimental_dataprestable=1&apikey=596f8653-37a9-4aca-9e49-73d83164925f&ads=enabled
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a02:6b8::2b8 , Russian Federation, ASN13238 (YANDEX, RU),
Reverse DNS
Software: /
Resource Hash: 6ba4f30215462f931c413a6dbf074eadb33f6b1f6024383ec466a394597ca137

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

access-control-allow-origin: *
date: Fri, 05 Apr 2024 12:41:50 GMT
cache-control: max-age=7654321
x-l7-hostname: aqeylvbyvzymsabt.vla.yp-c.yandex.net
content-length: 159
etag: "50d413299e6d280bb3b127c5b44ba049"
content-type: image/png

GET
H2 200 tiles
core-renderer-tiles.maps.yandex.net/ 5 KB
5 KB 237ms
236ms Image
image/png 2a02:6b8::2b8
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://core-renderer-tiles.maps.yandex.net/tiles?l=map&v=24.04.05-1&x=1249&y=749&z=11&scale=1&lang=ru_RU&experimental_dataprestable=1&apikey=596f8653-37a9-4aca-9e49-73d83164925f&ads=enabled
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a02:6b8::2b8 , Russian Federation, ASN13238 (YANDEX, RU),
Reverse DNS
Software: /
Resource Hash: b2c30df144613af724425eaedcc4aa1fa7b9e3507e0ecc2aa88f137040728234

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

access-control-allow-origin: *
date: Fri, 05 Apr 2024 12:41:50 GMT
cache-control: max-age=7654321
x-l7-hostname: k5bvqe7etzlzsnzi.vla.yp-c.yandex.net
content-length: 4859
etag: "b4e0da7d4a28e3a85d8817e66383d6ee"
content-type: image/png

GET
H2 200 tiles
core-renderer-tiles.maps.yandex.net/ 28 KB
28 KB 229ms
228ms Image
image/png 2a02:6b8::2b8
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://core-renderer-tiles.maps.yandex.net/tiles?l=map&v=24.04.05-1&x=1250&y=749&z=11&scale=1&lang=ru_RU&experimental_dataprestable=1&apikey=596f8653-37a9-4aca-9e49-73d83164925f&ads=enabled
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a02:6b8::2b8 , Russian Federation, ASN13238 (YANDEX, RU),
Reverse DNS
Software: /
Resource Hash: 5ee33dfe5786496c620ebc89adfd75071338ef58f077616ec51f468c02461169

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

access-control-allow-origin: *
date: Fri, 05 Apr 2024 12:41:50 GMT
cache-control: max-age=7654321
x-l7-hostname: yokonrwm77ogudjv.sas.yp-c.yandex.net
content-length: 28609
etag: "f7d82a8421e33dd53450dccaf91dcac3"
content-type: image/png

GET
H2 200 tiles
core-renderer-tiles.maps.yandex.net/ 28 KB
29 KB 232ms
232ms Image
image/png 2a02:6b8::2b8
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://core-renderer-tiles.maps.yandex.net/tiles?l=map&v=24.04.05-1&x=1251&y=749&z=11&scale=1&lang=ru_RU&experimental_dataprestable=1&apikey=596f8653-37a9-4aca-9e49-73d83164925f&ads=enabled
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a02:6b8::2b8 , Russian Federation, ASN13238 (YANDEX, RU),
Reverse DNS
Software: /
Resource Hash: 860e8fc2357b5541ce42cbd856e2a64b54ce7f6c89020894b6033195e0072abe

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

access-control-allow-origin: *
date: Fri, 05 Apr 2024 12:41:50 GMT
cache-control: max-age=7654321
x-l7-hostname: nsjzxuiotoyglnhn.sas.yp-c.yandex.net
content-length: 28955
etag: "88440ac4ec177a593292d2d655291db1"
content-type: image/png

GET
H2 200 tiles
core-renderer-tiles.maps.yandex.net/ 24 KB
24 KB 231ms
231ms Image
image/png 2a02:6b8::2b8
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://core-renderer-tiles.maps.yandex.net/tiles?l=map&v=24.04.05-1&x=1252&y=749&z=11&scale=1&lang=ru_RU&experimental_dataprestable=1&apikey=596f8653-37a9-4aca-9e49-73d83164925f&ads=enabled
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a02:6b8::2b8 , Russian Federation, ASN13238 (YANDEX, RU),
Reverse DNS
Software: /
Resource Hash: 2c76b7399b10987064cc3df257649e4249cd5d301e192832280ad8cdcd35ec7c

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

access-control-allow-origin: *
date: Fri, 05 Apr 2024 12:41:50 GMT
cache-control: max-age=7654321
x-l7-hostname: zsytis6vdjm5j3px.sas.yp-c.yandex.net
content-length: 24407
etag: "657d8eef917ab0998ce7f7aa14f535f7"
content-type: image/png

GET
H2 200 tiles
core-renderer-tiles.maps.yandex.net/ 28 KB
28 KB 327ms
326ms Image
image/png 2a02:6b8::2b8
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://core-renderer-tiles.maps.yandex.net/tiles?l=map&v=24.04.05-1&x=1253&y=749&z=11&scale=1&lang=ru_RU&experimental_dataprestable=1&apikey=596f8653-37a9-4aca-9e49-73d83164925f&ads=enabled
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a02:6b8::2b8 , Russian Federation, ASN13238 (YANDEX, RU),
Reverse DNS
Software: /
Resource Hash: e3446e84775c59aa0a93cbbff8531db98cbf502f8c73aaa98c163b267e2daeb2

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

access-control-allow-origin: *
date: Fri, 05 Apr 2024 12:41:50 GMT
cache-control: max-age=7654321
x-l7-hostname: vnqi54cabjsk4icw.klg.yp-c.yandex.net
content-length: 28946
etag: "d028732fa31ff1e3fac10c945e7cb696"
content-type: image/png

GET
H2 200 tiles
core-renderer-tiles.maps.yandex.net/ 28 KB
28 KB 194ms
193ms Image
image/png 2a02:6b8::2b8
YANDEX

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://core-renderer-tiles.maps.yandex.net/tiles?l=map&v=24.04.05-1&x=1254&y=749&z=11&scale=1&lang=ru_RU&experimental_dataprestable=1&apikey=596f8653-37a9-4aca-9e49-73d83164925f&ads=enabled
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a02:6b8::2b8 , Russian Federation, ASN13238 (YANDEX, RU),
Reverse DNS
Software: /
Resource Hash: 937945788638c57da0448362de984cfd5df5ce28d6270552789b2f535f51e85e

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

access-control-allow-origin: *
date: Fri, 05 Apr 2024 12:41:50 GMT
cache-control: max-age=7654321
x-l7-hostname: kena55txumczfl3t.klg.yp-c.yandex.net
content-length: 28430
etag: "afea57dd4ab54d4e65f2e6697ef0a615"
content-type: image/png

GET
H2 200 13.png
13.testfamilygarden.su/upload/img/ 15 KB
15 KB 507ms
506ms Image
image/png 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to Show image

Full URL: https://13.testfamilygarden.su/upload/img/13.png
Requested by: Host: 13.testfamilygarden.su
URL: https://13.testfamilygarden.su/
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: e30838a26f849ab332e679e9067ee336a3692f3b5c5e9c5d11b4497fca287097

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:51 GMT
last-modified: Wed, 13 Mar 2024 12:39:11 GMT
server: nginx
etag: "65f19e6f-3cd3"
content-type: image/png
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 15571
expires: Mon, 20 May 2024 12:41:51 GMT

GET
H2 200 favicon.png
13.testfamilygarden.su/local/templates/injir_dev/img/favicon/ 16 KB
16 KB 146ms
146ms Other
image/png 2a00:f940:2:2:1:3:0:216
AS-REG

General

Check archive.org

Show headers Download Go to

Full URL: https://13.testfamilygarden.su/local/templates/injir_dev/img/favicon/favicon.png
Protocol: H2
Security: TLS 1.3, , AES_256_GCM
Server: 2a00:f940:2:2:1:3:0:216 , Russian Federation, ASN197695 (AS-REG, RU),
Reverse DNS
Software: nginx /
Resource Hash: eef34192a9e46042a51895d6c77461805cefa3a29bd2be41ec55191a198edfa2

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
sec-ch-ua-platform: "Win32"

Response headers

date: Fri, 05 Apr 2024 12:41:52 GMT
last-modified: Wed, 13 Mar 2024 12:35:48 GMT
server: nginx
etag: "65f19da4-3fb6"
content-type: image/png
cache-control: max-age=3888000
accept-ranges: bytes
content-length: 16310
expires: Mon, 20 May 2024 12:41:52 GMT

POST
H2 200 89347546
mc.yandex.com/webvisor/ 43 B
0 919ms
162ms Fetch
image/gif 2a02:6b8::1:119
YANDEX

General

Check archive.org

Show headers Download Go to

Full URL

https://mc.yandex.com/webvisor/89347546?wv-part=1&wv-type=7&wmode=0&wv-hit=748472765&page-url=https%3A%2F%2F13.testfamilygarden.su%2F&rn=956242357&browser-info=bt%3A1%3Awe%3A1%3Aet%3A1712320914%3Aw%3A1600x1113%3Av%3A1290%3Az%3A-600%3Ai%3A20240405024153%3Au%3A1712320909960520166%3Avf%3A6q5vo8idydw3m5q59jr2ws8gr%3Ast%3A1712320914&t=gdpr(14)ti(1)

Requested by

Host: mc.yandex.ru
URL: https://mc.yandex.ru/metrika/tag.js

Protocol

Security

TLS 1.3, , AES_256_GCM

Server

2a02:6b8::1:119 , Russian Federation, ASN13238 (YANDEX, RU),

Reverse DNS

Software

Resource Hash

Security Headers

Name	Value
Strict-Transport-Security	max-age=31536000
X-Xss-Protection	1; mode=block

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
sec-ch-ua-platform: "Win32"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
Content-Type: text/plain

Response headers

pragma: no-cache
date: Fri, 05 Apr 2024 12:41:54 GMT
strict-transport-security: max-age=31536000
last-modified: Fri, 05-Apr-2024 12:41:54 GMT
content-type: image/gif
access-control-allow-origin: https://13.testfamilygarden.su
cache-control: private, no-cache, no-store, must-revalidate, max-age=0
access-control-allow-credentials: true
content-length: 43
x-xss-protection: 1; mode=block
expires: Fri, 05-Apr-2024 12:41:54 GMT

POST
H2 200 89347546
mc.yandex.com/webvisor/ 43 B
0 382ms
317ms Fetch
image/gif 2a02:6b8::1:119
YANDEX

General

Check archive.org

Show headers Download Go to

Full URL

https://mc.yandex.com/webvisor/89347546?wv-part=1&wv-type=7&wmode=0&wv-hit=748472765&page-url=https%3A%2F%2F13.testfamilygarden.su%2F&rn=654314472&browser-info=we%3A1%3Aet%3A1712320914%3Aw%3A1600x1113%3Av%3A1290%3Az%3A-600%3Ai%3A20240405024153%3Au%3A1712320909960520166%3Avf%3A6q5vo8idydw3m5q59jr2ws8gr%3Ast%3A1712320914&t=gdpr(14)ti(1)

Requested by

Host: mc.yandex.ru
URL: https://mc.yandex.ru/metrika/tag.js

Protocol

Security

TLS 1.3, , AES_256_GCM

Server

2a02:6b8::1:119 , Russian Federation, ASN13238 (YANDEX, RU),

Reverse DNS

Software

Resource Hash

Security Headers

Name	Value
Strict-Transport-Security	max-age=31536000
X-Xss-Protection	1; mode=block

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
sec-ch-ua-platform: "Win32"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
Content-Type: text/plain

Response headers

pragma: no-cache
date: Fri, 05 Apr 2024 12:41:54 GMT
strict-transport-security: max-age=31536000
last-modified: Fri, 05-Apr-2024 12:41:54 GMT
content-type: image/gif
access-control-allow-origin: https://13.testfamilygarden.su
cache-control: private, no-cache, no-store, must-revalidate, max-age=0
access-control-allow-credentials: true
content-length: 43
x-xss-protection: 1; mode=block
expires: Fri, 05-Apr-2024 12:41:54 GMT

POST
H2 200 89347546
mc.yandex.com/webvisor/ 43 B
0 155ms
153ms Fetch
image/gif 2a02:6b8::1:119
YANDEX

General

Check archive.org

Show headers Download Go to

Full URL

https://mc.yandex.com/webvisor/89347546?wv-part=2&wv-type=7&wmode=0&wv-hit=748472765&page-url=https%3A%2F%2F13.testfamilygarden.su%2F&rn=871293130&browser-info=bt%3A1%3Awe%3A1%3Aet%3A1712320916%3Aw%3A1600x1113%3Av%3A1290%3Az%3A-600%3Ai%3A20240405024156%3Au%3A1712320909960520166%3Avf%3A6q5vo8idydw3m5q59jr2ws8gr%3Ast%3A1712320916&t=gdpr(14)ti(1)

Requested by

Host: mc.yandex.ru
URL: https://mc.yandex.ru/metrika/tag.js

Protocol

Security

TLS 1.3, , AES_256_GCM

Server

2a02:6b8::1:119 , Russian Federation, ASN13238 (YANDEX, RU),

Reverse DNS

Software

Resource Hash

Security Headers

Name	Value
Strict-Transport-Security	max-age=31536000
X-Xss-Protection	1; mode=block

Request headers

sec-ch-ua: "Google Chrome";v="123", "Not:A-Brand";v="8", "Chromium";v="123"
sec-ch-ua-platform: "Win32"
Referer: https://13.testfamilygarden.su/
accept-language: en-US,en;q=0.9
sec-ch-ua-mobile: ?0
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/123.0.0.0 Safari/537.36
Content-Type: text/plain

Response headers

pragma: no-cache
date: Fri, 05 Apr 2024 12:41:56 GMT
strict-transport-security: max-age=31536000
last-modified: Fri, 05-Apr-2024 12:41:56 GMT
content-type: image/gif
access-control-allow-origin: https://13.testfamilygarden.su
cache-control: private, no-cache, no-store, must-revalidate, max-age=0
access-control-allow-credentials: true
content-length: 43
x-xss-protection: 1; mode=block
expires: Fri, 05-Apr-2024 12:41:56 GMT

Verdicts & Comments Add Verdict or Comment

48 JavaScript Global Variables

These are the non-standard "global" variables defined on the window object. These can be helpful in identifying possible client-side frameworks and code.

30 Cookies

Cookies are little pieces of information stored in the browser of a user. Whenever a user visits the site again, he will also send his cookie values, thus allowing the website to re-identify him even if he changed locations. This is how permanent logins work.

Domain/Path	Expires	Name / Value
.testfamilygarden.su/	1969-12-31 23:59:59	Name: PHPSESSID Value: tAz5i4NPfVINj8e93Q0qK6gr4NUoRoTt
.testfamilygarden.su/	1970-01-21 04:17:04	Name: BITRIX_SM_SALE_UID Value: 48f5d330ca61739e7d1d2fd40e5b20dd
.yandex.ru/	1970-01-21 05:14:40	Name: i Value: KdEcg/TnABf5WXEiSuqxCj1h073PS7TM5ZEfMEPmSjpfAfHMWWamfyMScDdq11l7BuupBknWjiMkr/FN9pRJUriKPe4=
.yandex.ru/	1970-01-21 05:14:40	Name: yandexuid Value: 7973066441712320907
.testfamilygarden.su/	1970-01-21 05:14:40	Name: _ga_JHVLHWW4WV Value: GS1.1.1712320908.1.0.1712320908.0.0.0
.testfamilygarden.su/	1970-01-21 05:14:40	Name: _ga Value: GA1.1.1493710073.1712320908
.bitrix.info/	1970-01-21 05:14:40	Name: bx_user_id Value: 571ece508c8c4bd046ce9baf40d540dd
.testfamilygarden.su/	1970-01-21 04:24:16	Name: BITRIX_CONVERSION_CONTEXT_f9 Value: %7B%22ID%22%3A474%2C%22EXPIRE%22%3A1712350740%2C%22UNIQUE%22%3A%5B%22conversion_visit_day%22%5D%7D
.yandex.ru/	1970-01-21 04:24:16	Name: yashr Value: 9601235691712320908
mc.yandex.ru/	1970-01-21 04:24:16	Name: bh Value: EkAiR29vZ2xlIENocm9tZSI7dj0iMTIzIiwgIk5vdDpBLUJyYW5kIjt2PSI4IiwgIkNocm9taXVtIjt2PSIxMjMiKgI/MDoHIldpbjMyIg==
13.testfamilygarden.su/	1970-01-21 05:14:40	Name: BX_USER_ID Value: 571ece508c8c4bd046ce9baf40d540dd
.testfamilygarden.su/	1970-01-21 04:24:16	Name: _ym_uid Value: 1712320909960520166
.testfamilygarden.su/	1970-01-21 04:24:16	Name: _ym_d Value: 1712320909
.mc.yandex.com/	1970-01-20 19:38:41	Name: sync_cookie_csrf Value: 1129839859fake
mc.yandex.com/	1970-01-21 04:24:16	Name: bh Value: EkAiR29vZ2xlIENocm9tZSI7dj0iMTIzIiwgIk5vdDpBLUJyYW5kIjt2PSI4IiwgIkNocm9taXVtIjt2PSIxMjMiKgI/MDoHIldpbjMyIg==
.yandex.com/	1970-01-21 04:24:16	Name: yashr Value: 953593811712320909
.testfamilygarden.su/	1970-01-20 19:39:52	Name: _ym_isad Value: 2
.mc.yandex.ru/	1970-01-20 19:38:41	Name: sync_cookie_csrf Value: 197374018fake
.yandex.com/	1970-01-21 04:24:16	Name: yandexuid Value: 7973066441712320907
.yandex.com/	1970-01-21 04:24:16	Name: yuidss Value: 7973066441712320907
.yandex.com/	1970-01-21 05:14:40	Name: i Value: KdEcg/TnABf5WXEiSuqxCj1h073PS7TM5ZEfMEPmSjpfAfHMWWamfyMScDdq11l7BuupBknWjiMkr/FN9pRJUriKPe4=
.yandex.com/	1970-01-21 05:14:40	Name: yp Value: 1712407309.yu.3558890491712320909
.mc.yandex.com/	1970-01-20 19:40:07	Name: sync_cookie_ok Value: synced
mc.yandex.com/	1969-12-31 23:59:59	Name: yabs-sid Value: 294643861712320909
.yandex.com/	1970-01-21 04:24:16	Name: ymex Value: 1714912909.oyu.3558890491712320909#1743856909.yrts.1712320909
.yandex.com/	1970-01-21 04:24:16	Name: receive-cookie-deprecation Value: 1
.yandex.com/	1970-01-21 04:24:16	Name: bh Value: Ej4iR29vZ2xlIENocm9tZSI7dj0iMTIzIiwiTm90OkEtQnJhbmQiO3Y9IjgiLCJDaHJvbWl1bSI7dj0iMTIzIhoFIng4NiIiECIxMjMuMC42MzEyLjEwNSIqAj8wOgciV2luMzIiQggiMTAuMC4wIkoEIjY0IlJbIkdvb2dsZSBDaHJvbWUiO3Y9IjEyMy4wLjYzMTIuMTA1IiwiTm90OkEtQnJhbmQiO3Y9IjguMC4wLjAiLCJDaHJvbWl1bSI7dj0iMTIzLjAuNjMxMi4xMDUiIg==
.testfamilygarden.su/	1970-01-20 19:38:42	Name: _ym_visorc Value: w
.yandex.ru/	1970-01-21 04:24:16	Name: receive-cookie-deprecation Value: 1
yandex.ru/	1970-01-21 04:24:16	Name: bh Value: EkAiR29vZ2xlIENocm9tZSI7dj0iMTIzIiwgIk5vdDpBLUJyYW5kIjt2PSI4IiwgIkNocm9taXVtIjt2PSIxMjMiKgI/MDoHIldpbjMyIg==

130 Console Messages

A page may trigger messages to the console to be logged. These are often error messages about being unable to load a resource or execute a piece of JavaScript. Sometimes they also provide insight into the technology behind a website.

Source	Level	URL Text
rendering	warning	URL: https://13.testfamilygarden.su/(Line 5) Message: The value "1.0initial-scale" for key "initial-scale" was truncated to its numeric prefix.
rendering	warning	URL: https://13.testfamilygarden.su/(Line 5) Message: The key "1.0" is not recognized and ignored.
other	warning	URL: https://13.testfamilygarden.su/(Line 1662) Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/(Line 1662) Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.
other	warning	URL: https://13.testfamilygarden.su/ Message: Third-party cookie will be blocked. Learn more in the Issues tab.

Indicators

This is a term in the security industry to describe indicators such as IPs, Domains, Hashes, etc. This does not imply that any of these indicate malicious activity.

13.testfamilygarden.su
api-maps.yandex.ru
bitrix.info
core-renderer-tiles.maps.yandex.net
mc.yandex.com
mc.yandex.ru
testfamilygarden.su
www.google-analytics.com
www.google.com
www.googletagmanager.com
www.gstatic.com
yandex.ru
yastatic.net
142.251.35.164
2607:f8b0:4006:81c::2008
2607:f8b0:4006:822::2003
2607:f8b0:4006:823::200e
2a00:f940:2:2:1:3:0:216
2a02:6b8:20::215
2a02:6b8::1:119
2a02:6b8::274
2a02:6b8::2b8
2a02:6b8:a::a
52.209.148.209
04820a7f50271590e1066f449b64d80a5cef60580f7d9bdf291a1029b9685048
060b8316a48a927c08ba4f7bd397f0206c668d8868a59de0f742c907a6de2be5
076b106e4fc52df63663083b6af2177c62e6a61b676ed8f68c5a614ef17338df
084df7cc48429dba4c355a61abeec3f6e94a6c92978066c87b96bf273655f467
090f40514478914d482828e00678d0f011a49730c079ce2ab77b4b83771d1c9c
09c0be0a371bb33ba741c05be1c160c7b404a395dd53ae1d6b9a64bf6c8e0317
0cb7353187dc0db57aae7a75e7ccf836f06c5d8c700d8d87694b6b4837ea63e6
11044a657158195c5a7669465a611336c670bbb95055953cc3fc60ab79831f8e
128811e08fc761c192794eadb0ca1ece135e0b3a8ea7d897c2f7f9fd5a37281f
1343e117aa1fb53f0892e90fe4a76b4d0224e677fd510a46fb8e7c28ba6c6fd5
13e327b334d10b2b24101040eecace86aaaa2eed03d282fa75a04aa3bebf69c1
13f48274ed06ca44d5882daadbd683ee3c1d83d24ef1ac39eb6671c408bb027d
17ccf93df899ac34c6994060c361e28a7d1ed28a12c7d3006358844ec15ee748
1ada416747b3fe5e1913dd5b02dc0a09c2d18c19fa631306b4baf274d59a439c
1c6707750fc8f9e2b20ac54a56e850d100cea0eea935e2de7b324661ab09390b
1e1d0e62accbbb68058907091cca9e56aa673f31bc136b24778cb57b2d88b814
204a64ce9f2f9676302a7cc1c85c01907361fa8334b6bae07aca9c9e1b252cec
215a175ce4fe873fe5ccb95770980ce28b5e46b844cd459f619e8371d5effc1e
223f57f72bb33e802fc66b326a7100d8cef4da591f595b343906a246b07c6153
22ab1479cfba1de431f64cc1d1cde62965c4f3aba72bdca1b695dce37ea8bcf0
28895789dd3be561ad371c1e6b510929c55462b646b0b7fb45486fe7d0679f4f
298dff5d20ebe5e7890b0e6cacab319f4849ef97c6ba70feacd1fd2c35a5fbb1
2a3d54ca32dbcd0df2887b44eda24da2a86408fd57715de8ea10b06af4c13931
2b43ab6c520b59d35d3fe36ac88dc61cea3c35922a8cd319392c61d4c0a0a956
2ba0565ef9d982b3231058fdf49551ad61cda8830b054505618d1216126f6142
2c5997b3a93101f814d3926dd767dab1dd2ed6433775975c7f80a4a7e14044cf
2c76b7399b10987064cc3df257649e4249cd5d301e192832280ad8cdcd35ec7c
2df685b0e54c65fb5e32c81ec4f6f550defa5803718127db5bd01a99a05f1adf
2fc899c40b90c5c41d2e533697dd8eb778b3b3b0c57b4888f330402f9da1fe4d
306f24411f6fb057c232014750d122afe35caf43190b32392d19ad679180afad
32742760e4b812e7c531ea2b76d6fe62ef8bf8d5ddd5bf55e81e221756910b42
336f5a298721b735faa9ef24529df7767553a671d02093d100aa9356708ef3d5
33a52784afc100b9d4ef4e47f3d1792bbdb91d5d8f71f1a6d4b1791a6c893fea
33b1f5cdacaf3a1c654bd220a4817c1395138b336fa519ab9963da0da48150ab
33bd1842b7778216197b870e8f3b4e387d9511905c04ea5a07934b3c614ef109
34e3661b7feb102836d058d5745d46d856b2891a8aafab0a1f34c3426b634adb
35e707ef75557161d9c8007889664a50e7375123dd40d7cf324a81d8cb2049f5
365e85a31de197b7e074e022301502692aa6f4d56ffca64b505546b986e8ffc0
386035e521437e06d2f2de96283b7a515c50520ac2678a37743e7be0b95a4883
39c772780a6c9f3afe53255eb60f20439c2fa626ea4cf392def8aecc8b8d1b6d
3bbc29438bce3f540f62e5cfa30da319479458594f0f3992a4735bf2cc16be77
3cc216e8dcf433a8d7f2ff75f27914da9fa2e8536b372f8b506144147dfe86c4
3ce1ebc4d7fd55b99e3c4b11fee7fe6a6cb1d8057adae61428ab79ac95e85b4c
3cecf49fbf8644f7b6e15c2f5d046399c1d417cab04b69c340c3d1a1ff0f052b
3da962311f19491248a0dcd9128d91820c46874d77514383fb49ca5958ac8a95
3fc93cc3f2dec261a4dbd670cfcf476a15f759d6b9066f30bb65e4082d032fdb
40df8d37c82a1abce04a1b68d8aec8b39c9c7a5254a7abdc3f52227dae45c4bf
4360c3725ed04bc567a922dc144de337f517ae903273a249dba2abba6d88b021
440b8f6b23db8984971d5bbeb571aecf14ad32395b755dcd12fc07f7fa708050
4634af17253ca8d7bba259e6eb1aa675a698771c10cf5643376d3643af252c90
4766221a7705ecc4bb03f528f54f9ed1546b87e8d0caf409e2c1edc692b11de3
480d0599fa7f00a993adecf4b7d6ff8ce3ea768643fd750b59ad0b40d2726ae6
4910f4f7670e058c7852ce56a45028dc4939b7f5931408960c30ebc4d0646b9d
4da167c6be67515b71879fb5576908ad9422cf6f61bcfe54e412ca7c36050d10
4e0902d25cdd2fa30a158a0ec715d36789d3282936b94c2b5997bd76e6035cd0
4e142bb69daa98530941895752ed378406e07e254dc81cfc3645eca10004e5a3
4e7b6fc8432a41fd57078d09bd47145a8a429b16f2ef77a24a57f482b08d20af
4fd74d7808584363092b9b0e2668269f87e47511a8f222ea0e69332a759ae8d0
5091a00509b006388997b171d01e78296119e41fe88889dfb50f9611bdb17804
515dfa6ae44eae1e79eea3414e838f70c3bcf76e67c1bbe57203caab418302d5
51740b2f965691265d745ad88000d13f35e9dde2c979fc14227fa5c2143fcb49
548f2d6f4d0d820c6c5ffbeffcbd7f0e73193e2932eefe542accc84762deec87
560bbd94cdf8011144efea0808a91b1465ef6223bf7335246b6558463ad23528
565339bc4d33d72817b583024112eb7f5cdf3e5eef0252d6ec1b9c9a94e12bb3
57ccdbbc1a3838c71a25faac4d615e96997889cee219477a69d827b1e8b6d8e3
59a67785c8767b2239b2fac0f6087f4f7cb3714b2e4203453f686ce5c736fa47
5ba170e9a1187ca539fbb55c6ac8ab845546d6a93b502826037f8882bf0a8471
5c9089c2a4075d0b6b2f1f9fca56b3edce7fdc920123bbfa1ba2b5083bf58fc4
5cb1e45ae23d8b26684696d51d3d1b9726073cad2d227b560a61a5a258ccf524
5ee33dfe5786496c620ebc89adfd75071338ef58f077616ec51f468c02461169
5fefde58a33af4d3087a08e0980364e02a65934b4148972ea8ecde1bc4057f84
64a1b172e2a5b00215bdf80d4a9ba6c006b5caeee3d4b098f6288303571c4232
65b6956a9126d7fd8afef3424837979dcaa0f2ac737339a745dbaefcd672dd39
680af6669abc319f9803f0fa26d443df1b6bc29133d88a8e4bea560ffed7288c
69010b4bf5e31d8feb8557c30e393c498fd880d1b020ecd30dad85f25b1bb5fb
6af8c3cd2e097fc664f9d23ab6e02888d686b69f51b37f3cee626de808fa5eb5
6ba4f30215462f931c413a6dbf074eadb33f6b1f6024383ec466a394597ca137
6c9b5de3c1416c5aec8d608287ac497758530c4f8228725bc33e49cbeee28382
73c97186fbb2f424fff0743cbf78c819edad9a1373e84e9c1ea4a60c10a3c117
74d1724c117e246ef69e8ba1e731c814adf0f845719032585a019464747f023e
766c76c75e53c41a6d3da422605d0030f86258ac36616a76f24a544f6cae3c1d
78351d19380118045a0512733bf54e656d4f964303d30b71ef7c7588706789c4
7957b3d7cde0278dc5d1cf9013a9c38967572dd362e52af6d1e8770af6435be3
7ab308f4548f873935923e12b63f10fef7b1cdff82a78ea68e65088de26eabc8
7af6f8ce9c1d2d549b23442cdd0bfca83c68afff232fdfae2185f942e4160dee
7afad46f43f492f5bef9d3c7841e255fba6b17355a4f4ad83b7be5c2f97fe595
7dfb9f0b18ec63c4a097f9d61e0c568b4338270adfe6145b1ab7d94eeabba54b
7e928161cd626935d39ff08188caa3f3a918811ca87194082dedf28b697ce6fd
818a646aaf656d181f790a550abfdcbafa0fb08974f7057467a795df2b96fca8
82b57b3950c6d43cffc1ae9c368581da06f54d161520de0d8c192f0e91407603
82c5b9363fbcdc6fa97dddedca1cd9697085d7ed7ff7543ae7d320f7f4a4de47
83baf8b049d65098236ab9abd8161634c8e9327ff4840fadacbe5f116689a408
83ce504460d68aaf5d90404a7035c268521e9a4b28b0c5034a6463cea2958599
84b3500a56da7d67f975577bee0f1f58ca10faa9f55119b56e2e2b6f1839403d
84da6a89aeb1d9f3510c49ffcaabb1e4f545bb970ec1ff2fe2eb47350084aecf
85e251ebd914bedddf4262fce695d37527c942b0dcd8aa09e7d414f1a21b57cc
860e8fc2357b5541ce42cbd856e2a64b54ce7f6c89020894b6033195e0072abe
887e09e3616f2d1f2bf37b28d4990c037a091430ece2e73796cba43742fa2b14
89144f304bc6fbc4131cb89b91c50bc8fa962565073e1b359c622eae966b3ff0
897c58672b375fd206d4df4ccd71a3fa3e29f739f4db5251b94895ad015f9710
8e5486050716939cd6b2cf6ce49742148fe3b48d63d0f817a1c7d69c6a6909ae
90f21e0997ee4fca652d5aad8ccc321718c1eacfafc62974d3e6e8b289df95bd
9213565effd88d75970733943bdda5589cfdb7c9506b99ce00b3039a7aa79c2a
937945788638c57da0448362de984cfd5df5ce28d6270552789b2f535f51e85e
95e65dc8cda3b25ca96701386e7de9af82960b1fe88273275462eae7ff930ef7
964a4d53e48e35c325a87b2569fd2dbdd71c6c15e231a7c2fcdd9a7ae0088507
965651d572172019f1a0d1ba6f591b519f9e5bc08f897b37837a21b2df661d04
978bd747f44350478cb7404fc988d3e8f32af3e65c0910014b50586606f878c3
9973f5bfc7491f2776d31ad7e5c5b2b34a4137c4ab6aba983838476cec0e4dbe
9b56ca6f6260ac29ca3de8bb2185c38e191777da35b76783ac3f4f669e23e5c2
9b86e97e9daf56973888aee6caffd2c6b82bfcb111c9ec2f9ded50a7777668e0
9cfeddeac6bec7714f140da244af0823eb469e665411fc571451f889a1d7fa94
a0fb89588dc7b711c0ffddb5fa2f6852f670ef1f615985bb65b2ea446cceb79f
a1688cc54e006f9a2a5db4060956949c996786cf5f35e1e4e5ac7d0bcd9a9b18
a2b7ba32dbb0137b65eed0e687c1662de1b416619bc4c9e99f8a9003eaca4f7e
a2bb952d1c91af6a7519b93bb6966a6cd50e6cf440b7ff21ed99dd926dc55550
a47984c6e030b85e882529c3fac2224aa368e37ce6dbd3c10996c77da488d5ef
a4d0c3a8db46379d644607e385e4b513b652557e2f64c4a457b6d637b90e5c5b
a4e025e2f423531ef488606ff5bf0c937fa71d6c7250bee0801d1efd32cad97e
a5c2329e04bc3b306276f194a4524a28f368a6559c058484f0549e764f0c1cc1
a958d068ca75af240aeeb006bf0fb84219601c17232547dc4afa9811e1c5ece2
aaa1123f7de51ee7045b244699080040f6573afd98cfeef386798e264ca476e3
ab7cdce5cd5091e7b60f91d621da3b25a1335229b69e5e0caf4408042aec31a2
abc2a02dd3edeafe391961a4ee9e919b410bc7ab4f3a66fd4b9e25f3c0aa0a94
ac301e04134f0a6a5a96b2e9f056107818db1d84226f0cf85d700d196c44ed85
acbe01e0faa5e400651f4e7ac2cc85d50a8763db66412ebb9eb459828861df41
ad4edfb87b2f0f1f9fdf6338fdb26e5aa669dd85b54c46422cf89f9f0ff17dd8
b023b38a8513cf8f1d86ba82a1c9d0bfa8e31263baf1e1f1f5689a01de624390
b02d015f4b201ec844118a0fdf3b347bb10c3c39932333379cc6aa20b52bef69
b1deef9203bf93f6d7f5e5662c41ef427affb2dcf278dd0bf1692a408b552814
b24d9843229433cbbe357914a99a3023a8e2c1048f97e1322920c4f803974e73
b2c30df144613af724425eaedcc4aa1fa7b9e3507e0ecc2aa88f137040728234
b453799d6c5c5e40f1471b83613e502b5f03d0973d3e6bd1da8796d1c6aed049
b4d5f032063cd6f48a2b46f69c1c7c8e4739c9993fe53c6da6cab8616409b3a8
b6ec7bd05d9844d1d1001dbcf88d431322a4df591ef8240bbf22d2cdd711f745
b735486ae37515b6ba01849a81c1725ddca0cf1bce79131006be9104da66ff6e
ba6cf5f96ee234596479b7b93d4568c36363e2d2e1084cc0d375d4cfe9d41f53
bb1861ac650af8d03228af423b9fde0aced116ee4734519b881b188984f0f0f7
bc029e99bc2542fc7750f5765a7b59614309b00799abdbeceb22e2bcfbc88397
bccba0cf34252dd00de69ea640331f23c12b41c80b4026e17aebf8b9cbbad2d4
bce4059881819b924d7220acf1ec05791131c514dfc03b22b171c0fb00215ca5
bd49fd79768e2d723d3cda7746b7e21285728503b1d990b86e0e7173dc5c5829
be2c5de4c598954edbcf55fa036eba2c3d82e4ae31b353d67e9f6b89659a87e9
be981b0d13d53fb94270f245706a2ee5f6d6850718c5c6c6ddc6f563c80389b3
bf343826c69ad859bf5075280d90551bec1bd20de14779b79b093014a328c30f
c01bebf2da9370e8288899822389a31c7a427abdf664145824dde7bf03ff22f3
c04cb249205e1c7ed91b9ada1700c3319501b7a876e773a44c52ef389d070f9a
c13280e79f74109c5e3854822c0f0c972d0a57245c95b0b3762f9788bd918f8d
c3b1531a71fe32d9db65794b7f8b582b243130ffa74d40372930c2dd9977bf19
c4bce8d44f0d33288fa41dd2ef131b09efe7864eb6351188fc99e76aa279668a
c68a77505ed905ff6eafd879dea3e63fdf43b1033f0055d84057bfc57de20e98
c9af66753862fa0c5dfa45edf7586e88e5e0143c3b59782c7d66e13f68f06684
cab3833629733b6af3fbed5684a129c04be090f60f5c52e46a93487a0684e20d
cc423bd69fa3a31e88cf0ab7fbd9a6f07b77e156d64c985149da5e31edc795ea
cdaba1a2e0e1bc47de694a2b83beabb53eecca62dd8faefd0861db49d369b9ce
cddc1d34d99b031ff582ee0b7d9e6a0a5d83f21592d91a063910b724d0c2b420
ce17ee65b6eae1e71246051c00b760659c2b33de10c6472372a867196321d808
cecb43d9abbe069f2bd526b5ba0d2a0cc61c63171f4d5880fdca4e23171412cc
cfac6f2b21bde058afdc42bc6b28cc6b5347bd2d601e22a6a224376920f29c84
d1130028a17bc39301e0b46c2d9176d4430ad49cb9332fbc894c17a71917317d
d424d25ea64c0d546228debdef031e43d939d8e835b3fc0f32eba929ff1b2e31
d5b46696fd491539a2d8bb8be0dbba12b2eafc44722d3ab0868b2db51130ed81
d68a7f81eecb6506a65ff22ac6d00601bd764716f2d917050111fe2a38cc2fb3
d6f14b5619f1535a2261335a3385477d9db11d301d6af54443d86a4dbb9b9745
d76673426b53cca9f31f7b677597239ea8fe3e85c58ecbbceb05793a02d2385e
d8263d7d0275b2cc1ac1880dfa4b1b2aacc24ba527ddae5d050ee5e59d2e7465
d96cc8452ae4add7c02c8ce7012782d18ac036d91c4b88b82a5f2b04610c0284
da87bc3a48dcf368b1b9d85c8173dd2f11cba5f3bdb9646364e627af5cf45fa6
dd064f19db9c939c6b717410ea488cdf3f408a974f4ab140327912c9760e5273
dd91c38c9d4c690dc89ed6e86f8ca46f66914ffe7d6a5071b735f13b07d49e29
ddca6f1dfe3f2f8f62a2f748cafee82865735149a4ff4d586da02053791b3886
ddf8020cf453978d99568f65166dbece6fa9ea9cf791cd68e12c14e577908692
de1e399b07289f3b0a8d35142e363e128124a1185770e214e25e58030dad48e5
de940c620cc23f6224272e6752bcc29eb85e001caf8f0361aae5c08b886a4231
df0bc6e3d2b4c76bbcf716f79734b5558eeb42bf84ec30b9a5cd526d1e08bd18
df8e0e20eb7a96f90a3a9aba2402326bcff91df3f20be86b9965052c7276f9f6
e0c656a40f9a5b41b9f51b6e4f71d67cffef5cf3c2f80226a1c4688f2267fdb1
e144ef832340a28c93109458a08d4d5bcae01107a0a24bca8a8b20aa7dced402
e1632dc38a09dce6cb13781150c5c2559762113ac2fb5d3509827b2e23223742
e23cf2c5bac07a377f4a661fd5892d98ac7f40983630d52e6fbf8fde0456805a
e30838a26f849ab332e679e9067ee336a3692f3b5c5e9c5d11b4497fca287097
e3446e84775c59aa0a93cbbff8531db98cbf502f8c73aaa98c163b267e2daeb2
e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855
e47879993ba04778087685eb53bfc03caf05da15f89f87aec961bf7aa638817d
e47eff3e84b90069a12024203cd8b4814e6997c027d0408ecb7f25abe9003994
e5b7c029b0bf55b78d9c66a97fc2587c3161a5be15fb3624844e9326c17fc79b
e5f7da1d4c7bbbd3660585cf8342b671059d2fd6662361ae2e25d6aad613ac53
e85fcb0be6237ce7bdb8394f2c4a94e9db149dc50fdd6a118cf549802d1c3125
e86993249b62a7a0bc14f7bb8525b5a8bb5d8535fd24fd14e57efd44b55b5e84
ea2afa4ef0f67f49e0fdf9ef4fa6a82e39c323627d51605f0073188172939f83
eb69f540be1e416b7346017da48deaf5ba2f2ee0af366c04f1e374351b651872
ed69b1a3c1a91b533ea98479b82ae858342d0a96555bfeba5763cefa73001bb0
ee8e5262205bc89ab69f4d27ba8b9486a899e0c3059d36135faf8d07753b7e51
eef34192a9e46042a51895d6c77461805cefa3a29bd2be41ec55191a198edfa2
ef416e765e2598580a76d50d672a3cabd5fb956bcc3ccc7d799f9cd9143d8cfe
efd355a4a74778d21619b5ebec26d06b0657898e03c1c7988678c5afed5dd812
f0dce0acd3aafb8948c228c8036ef5c799729195bba5f9e9f1b3dbba560089b2
f150a093d12b653438da937c8bb7a9826e2681bc816156fea8b07ac77f1bcc3c
f168ed9e7c5064902b122a4d4c1697fb336c1dfe110823a92652cfed49b3884e
f16f0ba0ff026f770fe84e32a59c045ec0fdd183d827ac3d854a3578c3b4ff13
f312f6fe158efa56734374769ab57012dab12ed9e81f8fa627d6fbca897191f2
f3756825df5194a174b7a55ebd3b484c276766eef21343d34b053b98ed386801
f7f84985eb79f17de0f8c2292fa0b095c3cfadb9e89519f34d239d60594a1f8a
f93a11a6acdac35b0d29eb5989255601f36708a3a8cab98215a0b76fcc02612b
fa0a16328fb615dff4d75243466bf8d36535db1b6111d98276d33fc4c5e3b926
fa0fb26f6bdf7ec146fa4a57d7ff92f90b3db076682e66432471fd52d8f58328
fa48ab049e70b5a3f325f5bd1852fe5c696feedc2c292ff30359550487a5f3ba
faf03494b5e496d188fec56c490a136a399ee278c44e9118754518db1781496e
fb20a8e9132015afeb20c3176f0093a03f5a5f30860ff289acc7babe5edc87be
fb2ce73a76c34e4999105888edebc6babed57ad847170109aeee50d4eab48fd8
fd82a8bc7f7c133ad62957a94837307063cba8818f278a8059d06d463d731f38

13.testfamilygarden.su Open in urlscan Pro 2a00:f940:2:2:1:3:0:216 Public Scan

Summary

urlscan.io Verdict: No classification

Domain & IP information

Screenshot Live screenshot Full Image

Page Title

Detected technologies

Page Statistics

233 Requests

24 %HTTPS

82 %IPv6

10 Domains

13 Subdomains

12 IPs

3 Countries

15143 kBTransfer

19034 kBSize

30 Cookies

36 Outgoing links

Redirected requests

233 HTTP transactions Everything HTML Script AJAX CSS Image Expand all 4 data transactions

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

Response headers

Request headers

13.testfamilygarden.su Open in urlscan Pro
2a00:f940:2:2:1:3:0:216 Public Scan

Screenshot
Live screenshot

Full Image

233
Requests

24 %
HTTPS

82 %
IPv6

10
Domains

13
Subdomains

12
IPs

3
Countries

15143 kB
Transfer

19034 kB
Size

30
Cookies

233 HTTP transactions
4 data transactions