www.herringshoes.co.uk
Open in
urlscan Pro
194.39.166.128
Public Scan
Submitted URL: http://herringshoes.co.uk/
Effective URL: https://www.herringshoes.co.uk/
Submission Tags: tranco_l324
Submission: On March 15 via api from DE — Scanned from GB
Effective URL: https://www.herringshoes.co.uk/
Submission Tags: tranco_l324
Submission: On March 15 via api from DE — Scanned from GB
Form analysis
12 forms found in the DOM<form>
<fieldset>
<legend class="visuallyhidden">Consent Selection</legend>
<div id="CybotCookiebotDialogBodyFieldsetInnerContainer">
<div class="CybotCookiebotDialogBodyLevelButtonWrapper"><label class="CybotCookiebotDialogBodyLevelButtonLabel" for="CybotCookiebotDialogBodyLevelButtonNecessary"><strong class="CybotCookiebotDialogBodyLevelButtonDescription">Necessary
</strong></label>
<div class="CybotCookiebotDialogBodyLevelButtonSliderWrapper CybotCookiebotDialogBodyLevelButtonSliderWrapperDisabled"><input type="checkbox" id="CybotCookiebotDialogBodyLevelButtonNecessary"
class="CybotCookiebotDialogBodyLevelButton CybotCookiebotDialogBodyLevelButtonDisabled" disabled="disabled" checked="checked"> <span class="CybotCookiebotDialogBodyLevelButtonSlider"></span></div>
</div>
<div class="CybotCookiebotDialogBodyLevelButtonWrapper"><label class="CybotCookiebotDialogBodyLevelButtonLabel" for="CybotCookiebotDialogBodyLevelButtonPreferences"><strong class="CybotCookiebotDialogBodyLevelButtonDescription">Preferences
</strong></label>
<div class="CybotCookiebotDialogBodyLevelButtonSliderWrapper"><input type="checkbox" id="CybotCookiebotDialogBodyLevelButtonPreferences" class="CybotCookiebotDialogBodyLevelButton CybotCookiebotDialogBodyLevelConsentCheckbox"
data-target="CybotCookiebotDialogBodyLevelButtonPreferencesInline" checked="checked" tabindex="0"> <span class="CybotCookiebotDialogBodyLevelButtonSlider"></span></div>
</div>
<div class="CybotCookiebotDialogBodyLevelButtonWrapper"><label class="CybotCookiebotDialogBodyLevelButtonLabel" for="CybotCookiebotDialogBodyLevelButtonStatistics"><strong class="CybotCookiebotDialogBodyLevelButtonDescription">Statistics
</strong></label>
<div class="CybotCookiebotDialogBodyLevelButtonSliderWrapper"><input type="checkbox" id="CybotCookiebotDialogBodyLevelButtonStatistics" class="CybotCookiebotDialogBodyLevelButton CybotCookiebotDialogBodyLevelConsentCheckbox"
data-target="CybotCookiebotDialogBodyLevelButtonStatisticsInline" checked="checked" tabindex="0"> <span class="CybotCookiebotDialogBodyLevelButtonSlider"></span></div>
</div>
<div class="CybotCookiebotDialogBodyLevelButtonWrapper"><label class="CybotCookiebotDialogBodyLevelButtonLabel" for="CybotCookiebotDialogBodyLevelButtonMarketing"><strong class="CybotCookiebotDialogBodyLevelButtonDescription">Marketing
</strong></label>
<div class="CybotCookiebotDialogBodyLevelButtonSliderWrapper"><input type="checkbox" id="CybotCookiebotDialogBodyLevelButtonMarketing" class="CybotCookiebotDialogBodyLevelButton CybotCookiebotDialogBodyLevelConsentCheckbox"
data-target="CybotCookiebotDialogBodyLevelButtonMarketingInline" checked="checked" tabindex="0"> <span class="CybotCookiebotDialogBodyLevelButtonSlider"></span></div>
</div>
</div>
</fieldset>
</form>
<form><input type="checkbox" id="CybotCookiebotDialogBodyLevelButtonNecessaryInline" class="CybotCookiebotDialogBodyLevelButton CybotCookiebotDialogBodyLevelButtonDisabled" disabled="disabled" checked="checked"> <span
class="CybotCookiebotDialogBodyLevelButtonSlider"></span></form>
<form><input type="checkbox" id="CybotCookiebotDialogBodyLevelButtonPreferencesInline" class="CybotCookiebotDialogBodyLevelButton CybotCookiebotDialogBodyLevelConsentCheckbox" data-target="CybotCookiebotDialogBodyLevelButtonPreferences"
checked="checked" tabindex="0"> <span class="CybotCookiebotDialogBodyLevelButtonSlider"></span></form>
<form><input type="checkbox" id="CybotCookiebotDialogBodyLevelButtonStatisticsInline" class="CybotCookiebotDialogBodyLevelButton CybotCookiebotDialogBodyLevelConsentCheckbox" data-target="CybotCookiebotDialogBodyLevelButtonStatistics"
checked="checked" tabindex="0"> <span class="CybotCookiebotDialogBodyLevelButtonSlider"></span></form>
<form><input type="checkbox" id="CybotCookiebotDialogBodyLevelButtonMarketingInline" class="CybotCookiebotDialogBodyLevelButton CybotCookiebotDialogBodyLevelConsentCheckbox" data-target="CybotCookiebotDialogBodyLevelButtonMarketing" checked="checked"
tabindex="0"> <span class="CybotCookiebotDialogBodyLevelButtonSlider"></span></form>
<form class="CybotCookiebotDialogBodyLevelButtonSliderWrapper"><input type="checkbox" id="CybotCookiebotDialogBodyContentCheckboxPersonalInformation" class="CybotCookiebotDialogBodyLevelButton"> <span
class="CybotCookiebotDialogBodyLevelButtonSlider"></span></form>
Name: search — GET https://www.herringshoes.co.uk/search.php
<form name="search" action="https://www.herringshoes.co.uk/search.php" method="get" id="keyword_search"><input type="text" placeholder="search site" name="keyword" id="keyword" value="" class="ui-autocomplete-input" autocomplete="off" role="textbox"
aria-autocomplete="list" aria-haspopup="true"><input type="hidden" name="rand" value="35711710484103"><input type="hidden" name="mobile" value="1"><input type="hidden" name="sale_search" value="0"><input type="hidden" name="task"
value="newSearch"><input type="hidden" name="country_id" value="6"><input type="hidden" name="nsFrom" value="0"><input type="hidden" name="nsLimit" value="24"><input type="hidden" name="search_source" value="keyword_search"><input type="submit"
name="" value=""></form>
POST
<form method="post" action="">
<input type="hidden" name="countryChosen" value="1">
<div class="jqm_start_left"><label for="countryid">Shipping to:</label></div>
<div class="jqm_start_right">
<div class="jqmCountryDropdown">
<select name="countryid" id="countryid">
<option value="">-- Delivery Country --</option>
<option alt="---" value="92">------------</option>
<optgroup label="Most often used">
<option selected="selected" alt="GBR" value="6">UNITED KINGDOM</option>
<option alt="USA" value="44">UNITED STATES</option>
<option alt="DEU" value="8">GERMANY</option>
<option alt="AUS" value="11">AUSTRALIA</option>
<option alt="CHE" value="40">SWITZERLAND</option>
<option alt="FRA" value="7">FRANCE</option>
<option alt="IRL" value="34">REPUBLIC OF IRELAND</option>
<option alt="SGP" value="54">SINGAPORE</option>
<option alt="HKG" value="22">HONG KONG</option>
<option alt="ITA" value="9">ITALY</option>
</optgroup>
<optgroup label="Alphabetical list">
<option alt="AFG" value="121">AFGHANISTAN</option>
<option alt="ALA" value="122">ALAND ISLANDS</option>
<option alt="ALB" value="95">ALBANIA</option>
<option alt="DZA" value="123">ALGERIA</option>
<option alt="ASM" value="124">AMERICAN SAMOA</option>
<option alt="AND" value="110">ANDORRA</option>
<option alt="AGO" value="125">ANGOLA</option>
<option alt="AIA" value="126">ANGUILLA</option>
<option alt="ATA" value="127">ANTARCTICA</option>
<option alt="ATG" value="128">ANTIGUA AND BARBUDA</option>
<option alt="ARG" value="57">ARGENTINA</option>
<option alt="ARM" value="129">ARMENIA</option>
<option alt="ABW" value="130">ARUBA</option>
<option alt="AUS" value="11">AUSTRALIA</option>
<option alt="AUT" value="12">AUSTRIA</option>
<option alt="AZE" value="107">AZERBAIJAN</option>
<option alt="BHS" value="131">BAHAMAS</option>
<option alt="BHR" value="13">BAHRAIN</option>
<option alt="" value="74">BALTIC STATES</option>
<option alt="BGD" value="132">BANGLADESH</option>
<option alt="BRB" value="114">BARBADOS</option>
<option alt="BLR" value="98">BELARUS</option>
<option alt="BEL" value="79">BELGIUM</option>
<option alt="BLZ" value="133">BELIZE</option>
<option alt="BEN" value="134">BENIN</option>
<option alt="BMU" value="14">BERMUDA</option>
<option alt="BFP" value="85">BFPO</option>
<option alt="BTN" value="135">BHUTAN</option>
<option alt="BOL" value="136">BOLIVIA</option>
<option alt="BES" value="137">BONAIRE, SEB</option>
<option alt="BIH" value="88">BOSNIA</option>
<option alt="BWA" value="138">BOTSWANA</option>
<option alt="BVT" value="139">BOUVET ISLAND</option>
<option alt="BRA" value="103">BRAZIL</option>
<option alt="IOT" value="140">BRITISH INDIAN OCEAN TERRITORY</option>
<option alt="BRN" value="82">BRUNEI</option>
<option alt="BGR" value="76">BULGARIA</option>
<option alt="BFA" value="141">BURKINA FASO</option>
<option alt="BDI" value="142">BURUNDI</option>
<option alt="KHM" value="143">CAMBODIA</option>
<option alt="CMR" value="144">CAMEROON</option>
<option alt="CAN" value="93">CANADA</option>
<option alt="CPV" value="145">CAPE VERDE</option>
<option alt="CYM" value="89">CAYMAN ISLANDS</option>
<option alt="CAF" value="146">CENTRAL AFRICAN REPUBLIC</option>
<option alt="TCD" value="147">CHAD</option>
<option alt="CHL" value="71">CHILE</option>
<option alt="CHN" value="15">CHINA</option>
<option alt="CXR" value="148">CHRISTMAS ISLAND</option>
<option alt="CCK" value="149">COCOS (KEELING) ISLANDS</option>
<option alt="COL" value="150">COLOMBIA</option>
<option alt="COM" value="151">COMOROS</option>
<option alt="COG" value="152">CONGO</option>
<option alt="COD" value="153">CONGO, DR</option>
<option alt="COK" value="154">COOK ISLANDS</option>
<option alt="CRI" value="155">COSTA RICA</option>
<option alt="CIV" value="156">COTE D'IVOIRE</option>
<option alt="HRV" value="16">CROATIA</option>
<option alt="CUB" value="157">CUBA</option>
<option alt="XC" value="158">CURACAO</option>
<option alt="CYP" value="17">CYPRUS</option>
<option alt="CZE" value="59">CZECH REPUBLIC</option>
<option alt="DNK" value="10">DENMARK</option>
<option alt="DJI" value="159">DJIBOUTI</option>
<option alt="DMA" value="160">DOMINICA</option>
<option alt="DOM" value="161">DOMINICAN REPUBLIC</option>
<option alt="ECU" value="119">ECUADOR</option>
<option alt="EGY" value="60">EGYPT</option>
<option alt="SLV" value="162">EL SALVADOR</option>
<option alt="GNQ" value="163">EQUATORIAL GUINEA</option>
<option alt="ERI" value="164">ERITREA</option>
<option alt="EST" value="18">ESTONIA</option>
<option alt="ETH" value="165">ETHIOPIA</option>
<option alt="FLK" value="166">FALKLAND ISLANDS</option>
<option alt="FRO" value="167">FAROE ISLANDS</option>
<option alt="FJI" value="168">FIJI</option>
<option alt="FIN" value="19">FINLAND</option>
<option alt="FRA" value="7">FRANCE</option>
<option alt="GUF" value="169">FRENCH GUIANA</option>
<option alt="PYF" value="170">FRENCH POLYNESIA</option>
<option alt="ATF" value="171">FRENCH SOUTHERN TERRITORIES</option>
<option alt="GAB" value="172">GABON</option>
<option alt="GMB" value="173">GAMBIA</option>
<option alt="GEO" value="20">GEORGIA</option>
<option alt="DEU" value="8">GERMANY</option>
<option alt="GHA" value="174">GHANA</option>
<option alt="GIB" value="61">GIBRALTAR</option>
<option alt="" value="86">GRAN CANARIA</option>
<option alt="GRC" value="21">GREECE</option>
<option alt="GRL" value="62">GREENLAND</option>
<option alt="GRD" value="175">GRENADA</option>
<option alt="GLP" value="176">GUADELOUPE</option>
<option alt="GUM" value="177">GUAM</option>
<option alt="GTM" value="178">GUATEMALA</option>
<option alt="GGY" value="80">GUERNSEY</option>
<option alt="GIN" value="179">GUINEA</option>
<option alt="GNB" value="180">GUINEA-BISSAU</option>
<option alt="GUY" value="181">GUYANA</option>
<option alt="HTI" value="182">HAITI</option>
<option alt="HMD" value="183">HEARD ISLAND MI</option>
<option alt="HND" value="185">HONDURAS</option>
<option alt="HKG" value="22">HONG KONG</option>
<option alt="HUN" value="45">HUNGARY</option>
<option alt="ISL" value="63">ICELAND</option>
<option alt="IND" value="58">INDIA</option>
<option alt="IDN" value="55">INDONESIA</option>
<option alt="IRN" value="186">IRAN</option>
<option alt="IRQ" value="187">IRAQ</option>
<option alt="IMN" value="188">ISLE OF MAN</option>
<option alt="ISR" value="87">ISRAEL</option>
<option alt="ITA" value="9">ITALY</option>
<option alt="JAM" value="189">JAMAICA</option>
<option alt="JPN" value="23">JAPAN</option>
<option alt="JEY" value="24">JERSEY</option>
<option alt="JOR" value="46">JORDAN</option>
<option alt="KAZ" value="100">KAZAKHSTAN</option>
<option alt="KEN" value="190">KENYA</option>
<option alt="KIR" value="191">KIRIBATI</option>
<option alt="KOR" value="25">KOREA (South)</option>
<option alt="KWT" value="65">KUWAIT</option>
<option alt="KGZ" value="193">KYRGYZSTAN</option>
<option alt="LAO" value="194">LAOS</option>
<option alt="LVA" value="75">LATVIA</option>
<option alt="LBN" value="66">LEBANON</option>
<option alt="LSO" value="195">LESOTHO</option>
<option alt="LBR" value="196">LIBERIA</option>
<option alt="LBY" value="197">LIBYA</option>
<option alt="LIE" value="120">LIECHTENSTEIN</option>
<option alt="LTU" value="73">LITHUANIA</option>
<option alt="LUX" value="26">LUXEMBOURG</option>
<option alt="MAC" value="115">MACAO</option>
<option alt="MKD" value="198">MACEDONIA, FYR</option>
<option alt="MDG" value="199">MADAGASCAR</option>
<option alt="MWI" value="200">MALAWI</option>
<option alt="MYS" value="27">MALAYSIA</option>
<option alt="MDV" value="201">MALDIVES</option>
<option alt="MLI" value="202">MALI</option>
<option alt="MLT" value="67">MALTA</option>
<option alt="MHL" value="203">MARSHALL ISLANDS</option>
<option alt="MTQ" value="204">MARTINIQUE</option>
<option alt="MRT" value="205">MAURITANIA</option>
<option alt="MUS" value="111">MAURITIUS</option>
<option alt="MYT" value="206">MAYOTTE</option>
<option alt="MEX" value="52">MEXICO</option>
<option alt="FSM" value="207">MICRONESIA, FS</option>
<option alt="MDA" value="208">MOLDOVA</option>
<option alt="MCO" value="28">MONACO</option>
<option alt="MNG" value="209">MONGOLIA</option>
<option alt="MNE" value="91">MONTENEGRO</option>
<option alt="MSR" value="210">MONTSERRAT</option>
<option alt="MAR" value="211">MOROCCO</option>
<option alt="MOZ" value="212">MOZAMBIQUE</option>
<option alt="MMR" value="213">MYANMAR</option>
<option alt="NAM" value="214">NAMIBIA</option>
<option alt="NRU" value="215">NAURU</option>
<option alt="NPL" value="216">NEPAL</option>
<option alt="NLD" value="29">NETHERLANDS</option>
<option alt="NCL" value="217">NEW CALEDONIA</option>
<option alt="NZL" value="30">NEW ZEALAND</option>
<option alt="NIC" value="218">NICARAGUA</option>
<option alt="NER" value="219">NIGER</option>
<option alt="NGA" value="102">NIGERIA</option>
<option alt="NIU" value="220">NIUE</option>
<option alt="NFK" value="221">NORFOLK ISLAND</option>
<option alt="MNP" value="222">NORTHERN MARIANA ISLANDS</option>
<option alt="NOR" value="31">NORWAY</option>
<option alt="OMN" value="47">OMAN</option>
<option alt="PAK" value="32">PAKISTAN</option>
<option alt="PLW" value="223">PALAU</option>
<option alt="PSE" value="224">PALESTINE, STATE OF</option>
<option alt="PAN" value="225">PANAMA</option>
<option alt="PNG" value="226">PAPUA NEW GUINEA</option>
<option alt="PRY" value="112">PARAGUAY</option>
<option alt="PER" value="101">PERU</option>
<option alt="PHL" value="68">PHILIPPINES</option>
<option alt="PCN" value="227">PITCAIRN</option>
<option alt="POL" value="33">POLAND</option>
<option alt="PRT" value="69">PORTUGAL</option>
<option alt="PRI" value="228">PUERTO RICO</option>
<option alt="QAT" value="94">QATAR</option>
<option alt="IRL" value="34">REPUBLIC OF IRELAND</option>
<option alt="REU" value="229">REUNION</option>
<option alt="ROU" value="78">ROMANIA</option>
<option alt="RUS" value="35">RUSSIA</option>
<option alt="RWA" value="230">RWANDA</option>
<option alt="BLM" value="231">SAINT BARTHELEMY</option>
<option alt="SHN" value="232">SAINT HELENA, ATDC</option>
<option alt="LCA" value="234">SAINT LUCIA</option>
<option alt="MAF" value="235">SAINT MARTIN FP</option>
<option alt="SPM" value="236">SAINT PIERRE AND MIQUELON</option>
<option alt="VCT" value="237">SAINT VINCENT TG</option>
<option alt="WSM" value="238">SAMOA</option>
<option alt="SMR" value="113">SAN MARINO</option>
<option alt="STP" value="239">SAO TOME AND PRINCIPE</option>
<option alt="SAU" value="36">SAUDI ARABIA</option>
<option alt="SEN" value="240">SENEGAL</option>
<option alt="SRB" value="83">SERBIA</option>
<option alt="SYC" value="241">SEYCHELLES</option>
<option alt="SLE" value="242">SIERRA LEONE</option>
<option alt="SGP" value="54">SINGAPORE</option>
<option alt="SXM" value="243">SINT MAARTEN DP</option>
<option alt="SVK" value="90">SLOVAKIA</option>
<option alt="SVN" value="72">SLOVENIA</option>
<option alt="SLB" value="244">SOLOMON ISLANDS</option>
<option alt="SOM" value="245">SOMALIA</option>
<option alt="ZAF" value="109">SOUTH AFRICA</option>
<option alt="SGS" value="246">SOUTH GEORGIA TSSI</option>
<option alt="SSD" value="247">SOUTH SUDAN</option>
<option alt="ESP" value="38">SPAIN</option>
<option alt="LKA" value="70">SRI LANKA</option>
<option alt="KNA" value="233">ST. KITTS AND NEVIS</option>
<option alt="SDN" value="248">SUDAN</option>
<option alt="SUR" value="249">SURINAME</option>
<option alt="SJM" value="250">SVALBARD AND JAN MAYEN</option>
<option alt="SWZ" value="251">SWAZILAND</option>
<option alt="SWE" value="39">SWEDEN</option>
<option alt="CHE" value="40">SWITZERLAND</option>
<option alt="SYR" value="252">SYRIAN ARAB REPUBLIC</option>
<option alt="TWN" value="41">TAIWAN</option>
<option alt="TJK" value="253">TAJIKISTAN</option>
<option alt="TZA" value="254">TANZANIA</option>
<option alt="THA" value="53">THAILAND</option>
<option alt="TLS" value="255">TIMOR-LESTE</option>
<option alt="TGO" value="256">TOGO</option>
<option alt="TKL" value="257">TOKELAU</option>
<option alt="TON" value="258">TONGA</option>
<option alt="TTO" value="259">TRINIDAD AND TOBAGO</option>
<option alt="TUN" value="260">TUNISIA</option>
<option alt="TUR" value="42">TURKEY</option>
<option alt="TCA" value="262">TURKS AND CAICOS ISLANDS</option>
<option alt="TUV" value="263">TUVALU</option>
<option alt="UGA" value="264">UGANDA</option>
<option alt="UKR" value="84">UKRAINE</option>
<option alt="ARE" value="43">UNITED ARAB EMIRATES</option>
<option alt="GBR" value="6">UNITED KINGDOM</option>
<option alt="USA" value="44">UNITED STATES</option>
<option alt="URY" value="266">URUGUAY</option>
<option alt="UMI" value="265">US MINOR OUTLYING ISLANDS</option>
<option alt="UZB" value="117">UZBEKISTAN</option>
<option alt="VUT" value="267">VANUATU</option>
<option alt="VAT" value="184">VATICAN CITY</option>
<option alt="VEN" value="268">VENEZUELA</option>
<option alt="VNM" value="108">VIETNAM</option>
<option alt="VGB" value="269">VIRGIN ISLANDS, BRITISH</option>
<option alt="VIR" value="270">VIRGIN ISLANDS, US</option>
<option alt="WLF" value="271">WALLIS AND FUTUNA</option>
<option alt="" value="56">WEST INDIES</option>
<option alt="ESH" value="272">WESTERN SAHARA</option>
<option alt="YEM" value="48">YEMEN</option>
<option alt="ZMB" value="273">ZAMBIA</option>
<option alt="ZWE" value="274">ZIMBABWE</option>
</optgroup>
</select>
</div>
</div>
<div class="clearout"></div>
<div class="jqmCountryControls">
<div class="jqmCountryButtons"><input type="submit" value="change country" class="defaultButton unmarginedButton">
<!--<input type="button" value="close" class = 'defaultButton unmarginedButton jqmClose jqmCloseUnpos' />-->
</div>
<div class="jqmCountryRemember">
<label for="rememberMyCountry">Remember my country:</label> <input type="checkbox" name="rememberMyCountry" id="rememberMyCountry" checked="checked" value="1">
</div>
<div class="clearout"></div>
</div>
</form>
POST search.php
<form id="msb_form" action="search.php" enctype="" method="post"><input type="text" name="keyword" id="msb" value="" placeholder="Search" size="20"><input type="hidden" name="rand" value="7041710484103"><input type="hidden" name="sale_search"
value="0"><input type="hidden" name="task" value="newSearch"><input type="hidden" name="search_source" value="keyword_search"><input type="image" name="msb_go" id="msb_go" alt="Go"
src="https://assets.herringshoes.co.uk/images/22/system-search.png"></form>
Name: search — GET search.php
<form name="search" action="search.php" id="search" method="get">
<input type="hidden" name="task" value="search">
<!-- <input type = 'hidden' name = 'Types[]' value = '1' /> -->
<input type="hidden" name="nsFrom" value="0">
<input type="hidden" name="nsLimit" value="24">
<input type="hidden" name="country_id" value="6">
<div class="selector" id="styleselect"><label class="invisibleLabel" for="style" style="clear:left;">style: </label><select name="Tags[]" id="style">
<option value="">any style</option>
<option value="2">Oxfords</option>
<option value="202">Oxfords with toe cap</option>
<option value="1">Brogues</option>
<option value="79">Semi-brogues</option>
<option value="35">Loafers</option>
<option value="3">Monk shoes</option>
<option value="146">Double monks</option>
<option value="11">Boots</option>
<option value="14">Spectator/Two-tone</option>
<option value="37">Deck shoes</option>
<option value="99">Driving moccasins</option>
<option value="269">Sneakers</option>
<option value="268">Trainers</option>
<option value="43">Slippers</option>
<option value="10">Derby/Gibson</option>
</select></div>
<div class="selector" id="colourselect"><label class="invisibleLabel" for="colour">colour: </label><select name="Colours[]" id="colour">
<option value="">any colour</option>
<option value="1">Black</option>
<option value="2">Brown & tan</option>
<option value="3">Burgundy</option>
<option value="4">Blue</option>
<option value="20">Green</option>
<option value="42">Red</option>
<option value="43">White</option>
<option value="5">Other colours</option>
<option value="70">Grey</option>
</select></div>
<div class="selector" id="sizeselect"><label class="invisibleLabel" for="sizes">size: </label><select name="Sizes[]" id="sizes">
<option value="">any size</option>
<option value="35">UK 4 (Eur 38 / US 4.5)</option>
<option value="1">UK 5 (Eur 39 / US 6)</option>
<option value="2">UK 5.5 (Eur 39.5 / US 6.5)</option>
<option value="3">UK 6 (Eur 40 / US 7)</option>
<option value="4">UK 6.5 (Eur 40.5 / US 7.5)</option>
<option value="5">UK 7 (Eur 41 / US 8)</option>
<option value="6">UK 7.5 (Eur 41.5 / US 8.5)</option>
<option value="7">UK 8 (Eur 42 / US 9)</option>
<option value="8">UK 8.5 (Eur 42.5 / US 9.5)</option>
<option value="9">UK 9 (Eur 43 / US 10)</option>
<option value="10">UK 9.5 (Eur 43.5 / US 10.5)</option>
<option value="11">UK 10 (Eur 44 / US 11)</option>
<option value="12">UK 10.5 (Eur 44.5 / US 11.5)</option>
<option value="13">UK 11 (Eur 45 / US 12)</option>
<option value="14">UK 11.5 (Eur 45.5 / US 12.5)</option>
<option value="15">UK 12 (Eur 46 / US 13)</option>
<option value="20">UK 12.5 (Eur 46.5 / US 13.5)</option>
<option value="16">UK 13 (Eur 47 / US 14)</option>
<option value="23">UK 13.5 (Eur 47.5 / US 14.5)</option>
<option value="21">UK 14 (Eur 48 / US 15)</option>
<option value="22">UK 15 (Eur 49 / US 16)</option>
</select></div>
<div class="selector" id="fitselect"><label class="invisibleLabel" for="fit" style="clear:left;">fit: </label><select name="Fits[]" id="fit">
<option selected="selected" value="">any fit</option>
<option value="1">E - Narrow</option>
<option value="2">F - Medium</option>
<option value="3">G - Wide</option>
<option value="6">H - Very Wide</option>
<option value="13">D - Very Narrow</option>
</select></div>
<div class="selector" id="priceselect">
<div class="searchSfpContainer">
<div class="searchCentreBox centreInParent"><label for="saleFullPrice_0">full price</label> <input type="radio" checked="checked" name="sale_search" id="saleFullPrice_0" value="0"> <label for="saleFullPrice_1">sale</label> <input type="radio"
name="sale_search" id="saleFullPrice_1" value="1"></div>
</div>
<div class="searchSfpContainer searchSfpContainerBottom">
<div class="searchCentreBox centreInParent"><label class="widerSearchFormLabel" for="inStock_1">available in stock</label> <input type="checkbox" name="inStock" id="inStock_1" value="1"><input type="hidden" id="inStockOverrideBehaviour"
name="inStockOverrideBehaviour" value="respect"></div>
</div>
<div class="clearout"></div>
</div>
<div class="selector" id="clearanceselect"><input type="hidden" name="search_source" value="normal_search_box"><input type="submit" value="Search" id="searchBig" class="defaultButton buttonHome solidColourButton"></div>
</form>
<form class="needsclick klaviyo-form klaviyo-form-version-cid_2 kl-private-reset-css-Xuajs1" data-testid="klaviyo-form-Xn3vkC" novalidate="" tabindex="-1"
style="display: flex; flex-direction: row; box-sizing: border-box; width: 100%; overflow: visible; max-width: 600px; margin: 0px auto; border-radius: 2px; border-style: none; border-width: 0px; border-color: rgb(0, 0, 0); background-color: rgb(255, 255, 255); background-repeat: no-repeat; background-position-y: 50%; padding: 16px; flex: 1 1 0%;">
<div class="needsclick kl-private-reset-css-Xuajs1" style="display: flex; flex-direction: column; width: 100%; margin: 0px; padding: 0px; min-height: 251px; justify-content: center;">
<div data-testid="form-row" class="needsclick kl-private-reset-css-Xuajs1" style="display: flex; flex-direction: row; align-items: stretch; position: relative;">
<div component="[object Object]" data-testid="form-component" class="needsclick kl-private-reset-css-Xuajs1" style="display: flex; justify-content: flex-start; padding: 0px 6px; position: relative; flex: 1 0 0px;">
<div class="kl-private-reset-css-Xuajs1 go3176171171" id="rich-text-78744887" style="width: 100%;">
<p style="text-align:center;font-size:14px;font-family:Arial, 'Helvetica Neue', Helvetica, sans-serif;font-weight:400;"><span class="ql-font-gill-sans-nova"
style="font-size:30px;color:rgb(0, 27, 70);font-family:gill-sans-nova, Helvetica, Arial, sans-serif;font-weight:bold;">Stay updated!</span></p>
</div>
</div>
</div>
<div data-testid="form-row" class="needsclick kl-private-reset-css-Xuajs1" style="display: flex; flex-direction: row; align-items: stretch; position: relative;">
<div component="[object Object]" data-testid="form-component" class="needsclick kl-private-reset-css-Xuajs1" style="display: flex; justify-content: flex-start; padding: 10px; position: relative; flex: 1 0 0px;">
<div class="kl-private-reset-css-Xuajs1 go3176171171" id="rich-text-78744888" style="width: 100%;">
<p style="text-align:center;font-size:14px;font-family:Arial, 'Helvetica Neue', Helvetica, sans-serif;font-weight:400;"><span class="ql-font-gill-sans-nova"
style="color:rgb(55, 63, 71);font-size:18px;font-family:gill-sans-nova, Helvetica, Arial, sans-serif;font-weight:400;">Sign up to get email updates about exclusive sales, new collections and styling tips.</span></p>
</div>
</div>
</div>
<div data-testid="form-row" class="needsclick kl-private-reset-css-Xuajs1" style="display: flex; flex-direction: row; align-items: stretch; position: relative;">
<div component="[object Object]" data-testid="form-component" class="needsclick kl-private-reset-css-Xuajs1" style="display: flex; justify-content: flex-start; padding: 10px 6px; position: relative; flex: 1 0 0px;">
<div class="needsclick kl-private-reset-css-Xuajs1" style="display: flex; flex-grow: 1; flex-direction: column; align-self: flex-end;"><input id="first_name_78744889" class="needsclick go3704654619 kl-private-reset-css-Xuajs1" type="text"
autocomplete="given-name" tabindex="0" placeholder="First name" aria-label="First name" aria-invalid="false" options="[object Object]"
style="box-sizing: border-box; border-radius: 4px; padding: 0px 0px 0px 16px; height: 50px; text-align: left; color: rgb(0, 0, 0); font-family: gill-sans-nova, Helvetica, Arial, sans-serif; font-size: 18px; font-weight: 400; letter-spacing: 0px; background-color: rgb(255, 255, 255); border: 1px solid rgb(0, 27, 70);">
<div class="needsclick kl-private-reset-css-Xuajs1" style="width: 100%; position: relative;"></div>
</div>
</div>
</div>
<div data-testid="form-row" class="needsclick kl-private-reset-css-Xuajs1" style="display: flex; flex-direction: row; align-items: stretch; position: relative;">
<div component="[object Object]" data-testid="form-component" class="needsclick kl-private-reset-css-Xuajs1" style="display: flex; justify-content: flex-start; padding: 0px 6px; position: relative; flex: 1 0 0px;">
<div class="needsclick kl-private-reset-css-Xuajs1" style="display: flex; flex-grow: 1; flex-direction: column; align-self: flex-end;"><input id="email_78744890" class="needsclick go3704654619 kl-private-reset-css-Xuajs1" type="email"
autocomplete="email" name="email" tabindex="0" placeholder="Email" aria-label="Email" aria-invalid="false" options="[object Object]"
style="box-sizing: border-box; border-radius: 4px; padding: 0px 0px 0px 16px; height: 50px; text-align: left; color: rgb(0, 0, 0); font-family: gill-sans-nova, Helvetica, Arial, sans-serif; font-size: 18px; font-weight: 400; letter-spacing: 0px; background-color: rgb(255, 255, 255); border: 1px solid rgb(0, 27, 70);">
<div class="needsclick kl-private-reset-css-Xuajs1" style="width: 100%; position: relative;"></div>
</div>
</div>
</div>
<div data-testid="form-row" class="needsclick kl-private-reset-css-Xuajs1" style="display: flex; flex-direction: row; align-items: stretch; position: relative;">
<div component="[object Object]" data-testid="form-component" class="needsclick kl-private-reset-css-Xuajs1" style="display: flex; justify-content: flex-start; padding: 10px 6px; position: relative; flex: 1 0 0px;">
<div class="needsclick kl-private-reset-css-Xuajs1" style="width: 100%; justify-content: flex-start; display: flex;">
<div class="needsclick go2376614969 kl-private-reset-css-Xuajs1" style="align-self: flex-end; display: block;"><label id="kl_Newsletter%20gender__5_label" class="needsclick kl-private-reset-css-Xuajs1"
style="color: rgb(0, 0, 0); font-family: gill-sans-nova, Helvetica, Arial, sans-serif; font-size: 18px; font-weight: 700; letter-spacing: 0px; padding-bottom: 6px; margin-right: 8px; margin-bottom: 8px;">What content would you like to
hear about?</label>
<div role="group" aria-labelledby="kl_Newsletter%20gender__5_label" class="needsclick kl-private-reset-css-Xuajs1" style="display: block;"><input tabindex="0" type="checkbox" id="Newsletter%20gender__5__15" name="Newsletter%20gender__5"
aria-invalid="false" aria-label="Men's" class="needsclick kl-private-reset-css-Xuajs1" style="position: absolute; width: 0px; opacity: 0;"><label for="Newsletter%20gender__5__15" class="needsclick kl-private-reset-css-Xuajs1"
style="display: flex; align-items: center; flex: 1 0 100%; padding-bottom: 8px; word-break: break-word; max-width: 100%; cursor: pointer;"><svg class="go19490161" width="20px" height="20px" viewBox="0 0 20 20" version="1.1"
xmlns="http://www.w3.org/2000/svg" aria-hidden="true" style="stroke: rgb(0, 27, 70); margin-right: 8px; min-width: 20px; width: auto; height: auto;">
<g>
<g>
<rect stroke-width="1" x="0.5" y="0.5" width="19" height="19" rx="2.22222222" fill="#FFFFFF"></rect>
</g>
</g>
</svg><svg width="20px" height="20px" viewBox="0 0 20 20" version="1.1" xmlns="http://www.w3.org/2000/svg" aria-hidden="true" style="cursor: pointer; display: none; position: absolute; margin: 0px;">
<defs></defs>
<g id="checkbox_inner_Newsletter%20gender__5__15" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
<g id="checkbox-on-checkbox_inner_Newsletter%20gender__5__15" transform="translate(3.000000, 4.000000)" fill="#303B43">
<polygon id="shape-checkbox_inner_Newsletter%20gender__5__15" fill="#000000" points="4.45454545 9.20149254 1.11363636 5.75373134 0 6.90298507 4.45454545 11.5 14 1.64925373 12.8863636 0.5"></polygon>
</g>
</g>
</svg>
<div class="needsclick kl-private-reset-css-Xuajs1"
style="cursor: pointer; color: rgb(0, 0, 0); font-family: gill-sans-nova, Helvetica, Arial, sans-serif; font-size: 18px; font-weight: 400; letter-spacing: 0px; margin-right: 24px; display: flex; position: relative; top: 1px;">Men's
</div>
</label><input tabindex="0" type="checkbox" id="Newsletter%20gender__5__16" name="Newsletter%20gender__5" aria-invalid="false" aria-label="Women's" class="needsclick kl-private-reset-css-Xuajs1"
style="position: absolute; width: 0px; opacity: 0;"><label for="Newsletter%20gender__5__16" class="needsclick kl-private-reset-css-Xuajs1"
style="display: flex; align-items: center; flex: 1 0 100%; padding-bottom: 8px; word-break: break-word; max-width: 100%; cursor: pointer;"><svg class="go19490161" width="20px" height="20px" viewBox="0 0 20 20" version="1.1"
xmlns="http://www.w3.org/2000/svg" aria-hidden="true" style="stroke: rgb(0, 27, 70); margin-right: 8px; min-width: 20px; width: auto; height: auto;">
<g>
<g>
<rect stroke-width="1" x="0.5" y="0.5" width="19" height="19" rx="2.22222222" fill="#FFFFFF"></rect>
</g>
</g>
</svg><svg width="20px" height="20px" viewBox="0 0 20 20" version="1.1" xmlns="http://www.w3.org/2000/svg" aria-hidden="true" style="cursor: pointer; display: none; position: absolute; margin: 0px;">
<defs></defs>
<g id="checkbox_inner_Newsletter%20gender__5__16" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
<g id="checkbox-on-checkbox_inner_Newsletter%20gender__5__16" transform="translate(3.000000, 4.000000)" fill="#303B43">
<polygon id="shape-checkbox_inner_Newsletter%20gender__5__16" fill="#000000" points="4.45454545 9.20149254 1.11363636 5.75373134 0 6.90298507 4.45454545 11.5 14 1.64925373 12.8863636 0.5"></polygon>
</g>
</g>
</svg>
<div class="needsclick kl-private-reset-css-Xuajs1"
style="cursor: pointer; color: rgb(0, 0, 0); font-family: gill-sans-nova, Helvetica, Arial, sans-serif; font-size: 18px; font-weight: 400; letter-spacing: 0px; margin-right: 24px; display: flex; position: relative; top: 1px;">
Women's</div>
</label><input tabindex="0" type="checkbox" id="Newsletter%20gender__5__17" name="Newsletter%20gender__5" aria-invalid="false" aria-label="Everything" class="needsclick kl-private-reset-css-Xuajs1"
style="position: absolute; width: 0px; opacity: 0;"><label for="Newsletter%20gender__5__17" class="needsclick kl-private-reset-css-Xuajs1"
style="display: flex; align-items: center; flex: 1 0 100%; padding-bottom: 8px; word-break: break-word; max-width: 100%; cursor: pointer;"><svg class="go19490161" width="20px" height="20px" viewBox="0 0 20 20" version="1.1"
xmlns="http://www.w3.org/2000/svg" aria-hidden="true" style="stroke: rgb(0, 27, 70); margin-right: 8px; min-width: 20px; width: auto; height: auto;">
<g>
<g>
<rect stroke-width="1" x="0.5" y="0.5" width="19" height="19" rx="2.22222222" fill="#FFFFFF"></rect>
</g>
</g>
</svg><svg width="20px" height="20px" viewBox="0 0 20 20" version="1.1" xmlns="http://www.w3.org/2000/svg" aria-hidden="true" style="cursor: pointer; display: none; position: absolute; margin: 0px;">
<defs></defs>
<g id="checkbox_inner_Newsletter%20gender__5__17" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
<g id="checkbox-on-checkbox_inner_Newsletter%20gender__5__17" transform="translate(3.000000, 4.000000)" fill="#303B43">
<polygon id="shape-checkbox_inner_Newsletter%20gender__5__17" fill="#000000" points="4.45454545 9.20149254 1.11363636 5.75373134 0 6.90298507 4.45454545 11.5 14 1.64925373 12.8863636 0.5"></polygon>
</g>
</g>
</svg>
<div class="needsclick kl-private-reset-css-Xuajs1"
style="cursor: pointer; color: rgb(0, 0, 0); font-family: gill-sans-nova, Helvetica, Arial, sans-serif; font-size: 18px; font-weight: 400; letter-spacing: 0px; margin-right: 24px; display: flex; position: relative; top: 1px;">
Everything</div>
</label></div>
<div class="needsclick kl-private-reset-css-Xuajs1" style="width: 100%; position: relative;"></div>
</div>
</div>
</div>
</div>
<div data-testid="form-row" class="needsclick kl-private-reset-css-Xuajs1" style="display: flex; flex-direction: row; align-items: stretch; position: relative;">
<div component="[object Object]" data-testid="form-component" class="needsclick kl-private-reset-css-Xuajs1" style="display: flex; justify-content: flex-start; padding: 10px 6px; position: relative; flex: 1 0 0px;"><button
class="needsclick go3753385069 kl-private-reset-css-Xuajs1" type="button" tabindex="0"
style="background: rgb(0, 27, 70); border-radius: 6px; border-style: none; border-color: rgb(0, 27, 70); border-width: 2px; color: rgb(255, 255, 255); font-family: gill-sans-nova, Helvetica, Arial, sans-serif; font-size: 20px; font-weight: 700; letter-spacing: 0px; line-height: 1; white-space: normal; padding-top: 0px; padding-bottom: 0px; text-align: center; word-break: break-word; align-self: flex-end; cursor: pointer; height: 52px; width: 100%;">Sign
up</button></div>
</div>
<div data-testid="form-row" class="needsclick kl-private-reset-css-Xuajs1" style="display: flex; flex-direction: row; align-items: stretch; position: relative;">
<div component="[object Object]" data-testid="form-component" class="needsclick kl-private-reset-css-Xuajs1" style="display: flex; justify-content: flex-start; padding: 10px 6px; position: relative; flex: 1 0 0px;">
<div class="kl-private-reset-css-Xuajs1 go3176171171" id="rich-text-78744893" style="width: 100%;">
<div>
<p class="ql-align-center" style="font-size: 14px; font-family: Arial, 'Helvetica Neue', Helvetica, sans-serif; font-weight: 400; text-align: left;"><span class="ql-font-gill-sans-nova"
style="color: #606a72; font-size: 12px; font-family: gill-sans-nova, Helvetica, Arial, sans-serif; font-weight: 400;">By submitting the form, you agree to receive marketing emails from Herring Shoes. You can opt out at anytime by
clicking the unsubscribe link in the email. View <a href="https://www.herringshoes.co.uk/privacy"><span style="text-decoration: underline;"><span style="color: #001b46;">Privacy Policy</span></span></a>.</span></p>
</div>
</div>
</div>
</div>
</div><input type="submit" tabindex="-1" value="Submit" style="display: none;">
</form>
<form class="needsclick klaviyo-form klaviyo-form-version-cid_1 kl-private-reset-css-Xuajs1" data-testid="klaviyo-form-WJ5rhY" novalidate="" tabindex="-1"
style="display: flex; flex-direction: row; box-sizing: border-box; width: 780px; min-width: 200px; max-width: 1000px; border-radius: 6px; border-style: none; border-width: 0px; border-color: rgb(0, 0, 0); background-color: rgb(255, 255, 255); background-repeat: no-repeat; background-position-y: 50%; padding: 15px 40px; flex: 1 1 0%;">
<div class="needsclick kl-private-reset-css-Xuajs1"
style="display: flex; flex-direction: column; width: 260px; margin: -15px 0px -15px -40px; padding: 0px; border-top: 0px solid transparent; border-right: 0px; border-bottom: 0px solid transparent; border-left: 0px solid transparent; border-bottom-left-radius: 6px; border-top-left-radius: 6px; overflow: hidden; min-width: 260px; min-height: 470px;">
<div class="needsclick kl-private-reset-css-Xuajs1"
style="background-image: url("https://d3k81ch9hvuctc.cloudfront.net/company/T7Engh/images/cb626383-be81-44b3-8f38-1efa9719c05a.jpeg"); background-repeat: no-repeat; background-size: cover; background-position: 50% 50%; width: 100%; height: 100%; display: block;">
</div>
</div>
<div class="needsclick kl-private-reset-css-Xuajs1" style="display: flex; flex-direction: column; width: 100%; margin: 0px; padding: 0px 0px 0px 40px; min-height: 470px; justify-content: center;">
<div data-testid="form-row" class="needsclick kl-private-reset-css-Xuajs1" style="display: flex; flex-direction: row; align-items: stretch; position: relative;">
<div component="[object Object]" data-testid="form-component" class="needsclick kl-private-reset-css-Xuajs1" style="display: flex; justify-content: flex-start; padding: 9px 6px; position: relative; flex: 1 0 0px;">
<div class="kl-private-reset-css-Xuajs1 go3176171171" id="rich-text-89251381" style="width: 100%;">
<p style="text-align:center;font-size:14px;font-family:Arial, 'Helvetica Neue', Helvetica, sans-serif;font-weight:400;"><span class="ql-font-gill-sans-nova"
style="font-size:36px;color:rgb(0, 27, 70);font-family:gill-sans-nova, Helvetica, Arial, sans-serif;font-weight:bold;">Unlock 10% off your</span></p>
<p style="text-align:center;font-size:14px;font-family:Arial, 'Helvetica Neue', Helvetica, sans-serif;font-weight:400;"><span class="ql-font-gill-sans-nova"
style="font-size:36px;color:rgb(0, 27, 70);font-family:gill-sans-nova, Helvetica, Arial, sans-serif;font-weight:bold;"> first order*</span></p>
</div>
</div>
</div>
<div data-testid="form-row" class="needsclick kl-private-reset-css-Xuajs1" style="display: flex; flex-direction: row; align-items: stretch; position: relative;">
<div component="[object Object]" data-testid="form-component" class="needsclick kl-private-reset-css-Xuajs1" style="display: flex; justify-content: flex-start; padding: 0px 6px 10px; position: relative; flex: 1 0 0px;">
<div class="kl-private-reset-css-Xuajs1 go3176171171" id="rich-text-89251382" style="width: 100%;">
<p style="text-align: center; font-size: 14px; font-family: Arial, 'Helvetica Neue', Helvetica, sans-serif; font-weight: 400;"><span style="font-size: 14px; font-family: gill-sans-nova, Helvetica, Arial, sans-serif; font-weight: 400;">Sign
up to get email updates about exclusive sales, new collections and styling tips. Add your phone number if you want to get an occasional text about our sales.</span></p>
</div>
</div>
</div>
<div data-testid="form-row" class="needsclick kl-private-reset-css-Xuajs1" style="display: flex; flex-direction: row; align-items: stretch; position: relative;">
<div component="[object Object]" data-testid="form-component" class="needsclick kl-private-reset-css-Xuajs1" style="display: flex; justify-content: flex-start; padding: 10px 6px 5px; position: relative; flex: 1 0 0px;">
<div class="needsclick kl-private-reset-css-Xuajs1" style="display: flex; flex-grow: 1; flex-direction: column; align-self: flex-end;"><input id="first_name_89251383" class="needsclick go1629648343 kl-private-reset-css-Xuajs1" type="text"
autocomplete="given-name" tabindex="0" placeholder="First name" aria-label="First name" aria-invalid="false" options="[object Object]"
style="box-sizing: border-box; border-radius: 4px; padding: 0px 0px 0px 16px; height: 50px; text-align: left; color: rgb(0, 0, 0); font-family: gill-sans-nova, Helvetica, Arial, sans-serif; font-size: 16px; font-weight: 400; letter-spacing: 0px; background-color: rgb(255, 255, 255); border: 1px solid rgb(0, 0, 0); box-shadow: rgba(0, 0, 0, 0) 0px 0px 5px;">
<div class="needsclick kl-private-reset-css-Xuajs1" style="width: 100%; position: relative;"></div>
</div>
</div>
</div>
<div data-testid="form-row" class="needsclick kl-private-reset-css-Xuajs1" style="display: flex; flex-direction: row; align-items: stretch; position: relative;">
<div component="[object Object]" data-testid="form-component" class="needsclick kl-private-reset-css-Xuajs1" style="display: flex; justify-content: flex-start; padding: 5px 6px 10px; position: relative; flex: 1 0 0px;">
<div class="needsclick kl-private-reset-css-Xuajs1" style="display: flex; flex-grow: 1; flex-direction: column; align-self: flex-end;"><input id="email_89251384" class="needsclick go1629648343 kl-private-reset-css-Xuajs1" type="email"
autocomplete="email" name="email" tabindex="0" placeholder="Email" aria-label="Email" aria-invalid="false" options="[object Object]"
style="box-sizing: border-box; border-radius: 4px; padding: 0px 0px 0px 16px; height: 50px; text-align: left; color: rgb(0, 0, 0); font-family: gill-sans-nova, Helvetica, Arial, sans-serif; font-size: 16px; font-weight: 400; letter-spacing: 0px; background-color: rgb(255, 255, 255); border: 1px solid rgb(96, 106, 114);">
<div class="needsclick kl-private-reset-css-Xuajs1" style="width: 100%; position: relative;"></div>
</div>
</div>
</div>
<div data-testid="form-row" class="needsclick kl-private-reset-css-Xuajs1" style="display: flex; flex-direction: row; align-items: stretch; position: relative;">
<div component="[object Object]" data-testid="form-component" class="needsclick kl-private-reset-css-Xuajs1" style="display: flex; justify-content: flex-start; padding: 10px 6px; position: relative; flex: 1 0 0px;">
<div class="needsclick kl-private-reset-css-Xuajs1" style="width: 100%; justify-content: flex-start; display: flex;">
<div class="needsclick go2376614969 kl-private-reset-css-Xuajs1" style="align-self: flex-end; display: block;"><label id="kl_Newsletter%20gender__14_label" class="needsclick kl-private-reset-css-Xuajs1"
style="color: rgb(0, 0, 0); font-family: gill-sans-nova, Helvetica, Arial, sans-serif; font-size: 16px; font-weight: 700; letter-spacing: 0px; padding-bottom: 6px; margin-right: 8px; margin-bottom: 8px;">What content would you like to
hear about?</label>
<div role="group" aria-labelledby="kl_Newsletter%20gender__14_label" class="needsclick kl-private-reset-css-Xuajs1" style="display: block;"><input tabindex="0" type="checkbox" id="Newsletter%20gender__14__22"
name="Newsletter%20gender__14" aria-invalid="false" aria-label="Male" class="needsclick kl-private-reset-css-Xuajs1" style="position: absolute; width: 0px; opacity: 0;"><label for="Newsletter%20gender__14__22"
class="needsclick kl-private-reset-css-Xuajs1" style="display: flex; align-items: center; flex: 1 0 100%; padding-bottom: 8px; word-break: break-word; max-width: 100%; cursor: pointer;"><svg class="go3360010050" width="20px"
height="20px" viewBox="0 0 20 20" version="1.1" xmlns="http://www.w3.org/2000/svg" aria-hidden="true" style="stroke: rgb(96, 106, 114); margin-right: 8px; min-width: 20px; width: auto; height: auto;">
<g>
<g>
<rect stroke-width="1" x="0.5" y="0.5" width="19" height="19" rx="2.22222222" fill="#FFFFFF"></rect>
</g>
</g>
</svg><svg width="20px" height="20px" viewBox="0 0 20 20" version="1.1" xmlns="http://www.w3.org/2000/svg" aria-hidden="true" style="cursor: pointer; display: none; position: absolute; margin: 0px;">
<defs></defs>
<g id="checkbox_inner_Newsletter%20gender__14__22" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
<g id="checkbox-on-checkbox_inner_Newsletter%20gender__14__22" transform="translate(3.000000, 4.000000)" fill="#303B43">
<polygon id="shape-checkbox_inner_Newsletter%20gender__14__22" fill="#000000" points="4.45454545 9.20149254 1.11363636 5.75373134 0 6.90298507 4.45454545 11.5 14 1.64925373 12.8863636 0.5"></polygon>
</g>
</g>
</svg>
<div class="needsclick kl-private-reset-css-Xuajs1"
style="cursor: pointer; color: rgb(0, 0, 0); font-family: gill-sans-nova, Helvetica, Arial, sans-serif; font-size: 16px; font-weight: 400; letter-spacing: 0px; margin-right: 24px; display: flex; position: relative; top: 1px;">Male
</div>
</label><input tabindex="0" type="checkbox" id="Newsletter%20gender__14__23" name="Newsletter%20gender__14" aria-invalid="false" aria-label="Female" class="needsclick kl-private-reset-css-Xuajs1"
style="position: absolute; width: 0px; opacity: 0;"><label for="Newsletter%20gender__14__23" class="needsclick kl-private-reset-css-Xuajs1"
style="display: flex; align-items: center; flex: 1 0 100%; padding-bottom: 8px; word-break: break-word; max-width: 100%; cursor: pointer;"><svg class="go3360010050" width="20px" height="20px" viewBox="0 0 20 20" version="1.1"
xmlns="http://www.w3.org/2000/svg" aria-hidden="true" style="stroke: rgb(96, 106, 114); margin-right: 8px; min-width: 20px; width: auto; height: auto;">
<g>
<g>
<rect stroke-width="1" x="0.5" y="0.5" width="19" height="19" rx="2.22222222" fill="#FFFFFF"></rect>
</g>
</g>
</svg><svg width="20px" height="20px" viewBox="0 0 20 20" version="1.1" xmlns="http://www.w3.org/2000/svg" aria-hidden="true" style="cursor: pointer; display: none; position: absolute; margin: 0px;">
<defs></defs>
<g id="checkbox_inner_Newsletter%20gender__14__23" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
<g id="checkbox-on-checkbox_inner_Newsletter%20gender__14__23" transform="translate(3.000000, 4.000000)" fill="#303B43">
<polygon id="shape-checkbox_inner_Newsletter%20gender__14__23" fill="#000000" points="4.45454545 9.20149254 1.11363636 5.75373134 0 6.90298507 4.45454545 11.5 14 1.64925373 12.8863636 0.5"></polygon>
</g>
</g>
</svg>
<div class="needsclick kl-private-reset-css-Xuajs1"
style="cursor: pointer; color: rgb(0, 0, 0); font-family: gill-sans-nova, Helvetica, Arial, sans-serif; font-size: 16px; font-weight: 400; letter-spacing: 0px; margin-right: 24px; display: flex; position: relative; top: 1px;">Female
</div>
</label><input tabindex="0" type="checkbox" id="Newsletter%20gender__14__24" name="Newsletter%20gender__14" aria-invalid="false" aria-label="Everything" class="needsclick kl-private-reset-css-Xuajs1"
style="position: absolute; width: 0px; opacity: 0;"><label for="Newsletter%20gender__14__24" class="needsclick kl-private-reset-css-Xuajs1"
style="display: flex; align-items: center; flex: 1 0 100%; padding-bottom: 8px; word-break: break-word; max-width: 100%; cursor: pointer;"><svg class="go3360010050" width="20px" height="20px" viewBox="0 0 20 20" version="1.1"
xmlns="http://www.w3.org/2000/svg" aria-hidden="true" style="stroke: rgb(96, 106, 114); margin-right: 8px; min-width: 20px; width: auto; height: auto;">
<g>
<g>
<rect stroke-width="1" x="0.5" y="0.5" width="19" height="19" rx="2.22222222" fill="#FFFFFF"></rect>
</g>
</g>
</svg><svg width="20px" height="20px" viewBox="0 0 20 20" version="1.1" xmlns="http://www.w3.org/2000/svg" aria-hidden="true" style="cursor: pointer; display: none; position: absolute; margin: 0px;">
<defs></defs>
<g id="checkbox_inner_Newsletter%20gender__14__24" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
<g id="checkbox-on-checkbox_inner_Newsletter%20gender__14__24" transform="translate(3.000000, 4.000000)" fill="#303B43">
<polygon id="shape-checkbox_inner_Newsletter%20gender__14__24" fill="#000000" points="4.45454545 9.20149254 1.11363636 5.75373134 0 6.90298507 4.45454545 11.5 14 1.64925373 12.8863636 0.5"></polygon>
</g>
</g>
</svg>
<div class="needsclick kl-private-reset-css-Xuajs1"
style="cursor: pointer; color: rgb(0, 0, 0); font-family: gill-sans-nova, Helvetica, Arial, sans-serif; font-size: 16px; font-weight: 400; letter-spacing: 0px; margin-right: 24px; display: flex; position: relative; top: 1px;">
Everything</div>
</label></div>
<div class="needsclick kl-private-reset-css-Xuajs1" style="width: 100%; position: relative;"></div>
</div>
</div>
</div>
</div>
<div data-testid="form-row" class="needsclick kl-private-reset-css-Xuajs1" style="display: flex; flex-direction: row; align-items: stretch; position: relative;">
<div component="[object Object]" data-testid="form-component" class="needsclick kl-private-reset-css-Xuajs1" style="display: flex; justify-content: flex-start; padding: 0px 6px; position: relative; flex: 1 0 0px;"><button
class="needsclick go2292092666 kl-private-reset-css-Xuajs1" type="button" tabindex="0"
style="background: rgb(0, 27, 70); border-radius: 6px; border-style: none; border-color: rgb(21, 117, 81); border-width: 2px; color: rgb(255, 255, 255); font-family: gill-sans-nova, Helvetica, Arial, sans-serif; font-size: 20px; font-weight: 700; letter-spacing: 0px; line-height: 1; white-space: normal; padding-top: 0px; padding-bottom: 0px; text-align: center; word-break: break-word; align-self: flex-end; cursor: pointer; height: 54px; width: 100%;">Unlock
Offer</button></div>
</div>
<div data-testid="form-row" class="needsclick kl-private-reset-css-Xuajs1" style="display: flex; flex-direction: row; align-items: stretch; position: relative;">
<div component="[object Object]" data-testid="form-component" class="needsclick kl-private-reset-css-Xuajs1" style="display: flex; justify-content: flex-start; padding: 15px 10px 20px; position: relative; flex: 1 0 0px;">
<div class="kl-private-reset-css-Xuajs1 go3176171171" id="rich-text-89251388" style="width: 100%;">
<p class="ql-align-center" style="font-size: 14px; font-family: Arial, 'Helvetica Neue', Helvetica, sans-serif; font-weight: 400; text-align: left;"><span class="ql-font-gill-sans-nova"
style="color: #606a72; font-size: 12px; font-family: gill-sans-nova, Helvetica, Arial, sans-serif; font-weight: 400;">By submitting this form and signing up to receive marketing emails from Herring Shoes. Unsubscribe at any time by
clicking the unsubscribe link in the emails. View <a href="https://www.herringshoes.co.uk/privacy"><span style="text-decoration: underline;"><span style="color: #001b46;">Privacy Policy</span></span></a>.</span></p>
<p class="ql-align-center" style="font-size: 14px; font-family: Arial, 'Helvetica Neue', Helvetica, sans-serif; font-weight: 400; text-align: left;"><span class="ql-font-gill-sans-nova"
style="color: #606a72; font-size: 12px; font-family: gill-sans-nova, Helvetica, Arial, sans-serif; font-weight: 400;">*Discount only applies to full-priced items. Sale items not included. New customers only.</span><span
class="ql-font-gill-sans-nova" style="color: #606a72; font-size: 12px; font-family: gill-sans-nova, Helvetica, Arial, sans-serif; font-weight: 400;"> </span></p>
</div>
</div>
</div>
<div data-testid="form-row" class="needsclick kl-private-reset-css-Xuajs1" style="display: flex; flex-direction: row; align-items: stretch; position: relative;">
<div component="[object Object]" data-testid="form-component" class="needsclick kl-private-reset-css-Xuajs1"
style="display: flex; justify-content: flex-start; padding: 0px 6px 10px; position: relative; background-color: rgba(255, 255, 255, 0); flex: 1 0 0px;"><button class="needsclick go952291206 kl-private-reset-css-Xuajs1" type="button"
tabindex="0"
style="background: rgb(255, 255, 255); border-radius: 2px; border-style: none; border-color: rgb(0, 0, 0); border-width: 0px; color: rgb(96, 106, 114); font-family: gill-sans-nova, Helvetica, Arial, sans-serif; font-size: 16px; font-weight: 700; letter-spacing: 0px; line-height: 1; white-space: normal; padding-top: 11px; padding-bottom: 11px; text-align: center; word-break: break-word; align-self: flex-end; cursor: pointer; height: auto; width: 100%;">No,
thanks</button></div>
</div>
</div><input type="submit" tabindex="-1" value="Submit" style="display: none;">
</form>
Text Content
Powered by Cookiebot * Consent * Details * [#IABV2SETTINGS#] * About THIS WEBSITE USES COOKIES We use cookies to personalise content and ads, to provide social media features and to analyse our traffic. We also share information about your use of our site with our social media, advertising and analytics partners who may combine it with other information that you’ve provided to them or that they’ve collected from your use of their services. Consent Selection Necessary Preferences Statistics Marketing Show details * Necessary 12 Necessary cookies help make a website usable by enabling basic functions like page navigation and access to secure areas of the website. The website cannot function properly without these cookies. * Google 3 Learn more about this provider test_cookiePending Expiry: 1 dayType: HTTP rc::aThis cookie is used to distinguish between humans and bots. This is beneficial for the website, in order to make valid reports on the use of their website. Expiry: PersistentType: HTML rc::cThis cookie is used to distinguish between humans and bots. Expiry: SessionType: HTML * Pinterest 1 Learn more about this provider is_euDetermines whether the user is located within the EU and therefore is subject to EU's data privacy regulations. Expiry: SessionType: HTML * WordPress.com 1 Learn more about this provider t.gifEnsures that product pictures are presented correctly on website. Expiry: SessionType: Pixel * assets.herringshoes.co.uk www.herringshoes.co.uk 2 SERVERID [x2]This cookie is used to assign the visitor to a specific server - this function is necessary for the functionality of the website. Expiry: SessionType: HTTP * live.conferwith.io 3 dmn_chk_# [x2]Pending Expiry: SessionType: HTTP cookietestThis cookie is used to determine if the visitor has accepted the cookie consent box. Expiry: SessionType: HTTP * www.herringshoes.co.uk 2 CookieConsentStores the user's cookie consent state for the current domain Expiry: 1 yearType: HTTP PHPSESSIDPreserves user session state across page requests. Expiry: SessionType: HTTP * Preferences 4 Preference cookies enable a website to remember information that changes the way the website behaves or looks, like your preferred language or the region that you are in. * Klaviyo 1 Learn more about this provider klaviyoOnsiteThe cookie is used to manage the mailing list, if the visitor has subscribed to any newsletters or blog posts. Expiry: PersistentType: HTML * live.conferwith.io 2 i18nextLngDetermines the preferred language of the visitor. Allows the website to set the preferred language upon the visitor's re-entry. Expiry: PersistentType: HTML storeDetermines the preferred language of the visitor. Allows the website to set the preferred language upon the visitor's re-entry. Expiry: PersistentType: HTML * www.herringshoes.co.uk 1 i18next.translate.booUsed in context with the language setting on the website. Facilitates the translation into the preferred language of the visitor. Expiry: PersistentType: HTML * Statistics 10 Statistic cookies help website owners to understand how visitors interact with websites by collecting and reporting information anonymously. * Google 1 Learn more about this provider tdRegisters statistical data on users' behaviour on the website. Used for internal analytics by the website operator. Expiry: SessionType: Pixel * Klaviyo 2 Learn more about this provider klaviyoPagesVisitCountStores data on the time spent on the website and its sub-pages, during the current session. Expiry: SessionType: HTML __kla_idThis cookie is used to collect information on the visitor's behavior. This information will be stored for internal use on the website – internal analytics is used to optimize the websites or to register if the visitor has subscribed to a newsletter. Expiry: 2 yearsType: HTTP * Mouseflow 2 Learn more about this provider mf_initialDomQueueRegisters data on visitors' website-behaviour. This is used for internal analysis and website optimization. Expiry: SessionType: HTML mf_transmitQueueCollects data on the user’s navigation and behavior on the website. This is used to compile statistical reports and heatmaps for the website owner. Expiry: SessionType: HTML * New Relic 1 Learn more about this provider NRBA_SESSIONCollects data on the user’s navigation and behavior on the website. This is used to compile statistical reports and heatmaps for the website owner. Expiry: PersistentType: HTML * WordPress.com 1 Learn more about this provider g.gifRegisters statistical data on users' behaviour on the website. Used for internal analytics by the website operator. Expiry: SessionType: Pixel * cdn.noibu.com 1 n_stored_page_visitCollects data on the user’s navigation and behavior on the website. This is used to compile statistical reports and heatmaps for the website owner. Expiry: PersistentType: HTML * herringshoes.co.uk 1 bIdRegisters statistical data on users' behaviour on the website. Used for internal analytics by the website operator. Expiry: 30 daysType: HTTP * live.conferwith.io 1 fingerPrintUsed to detect and log potential tracking errors. Expiry: PersistentType: HTML * Marketing 72 Marketing cookies are used to track visitors across websites. The intention is to display ads that are relevant and engaging for the individual user and thereby more valuable for publishers and third party advertisers. * Meta Platforms, Inc. 4 Learn more about this provider _fbp [x2]Used by Facebook to deliver a series of advertisement products such as real time bidding from third party advertisers. Expiry: 3 monthsType: HTTP lastExternalReferrerDetects how the user reached the website by registering their last URL-address. Expiry: PersistentType: HTML lastExternalReferrerTimeDetects how the user reached the website by registering their last URL-address. Expiry: PersistentType: HTML * Google 22 Learn more about this provider _ga [x5]Used to send data to Google Analytics about the visitor's device and behavior. Tracks the visitor across devices and marketing channels. Expiry: 2 yearsType: HTTP _ga_# [x2]Used to send data to Google Analytics about the visitor's device and behavior. Tracks the visitor across devices and marketing channels. Expiry: 2 yearsType: HTTP _gat [x2]Used to send data to Google Analytics about the visitor's device and behavior. Tracks the visitor across devices and marketing channels. Expiry: 1 dayType: HTTP _gcl_au [x2]Used by Google AdSense for experimenting with advertisement efficiency across websites using their services. Expiry: 3 monthsType: HTTP _gid [x5]Used to send data to Google Analytics about the visitor's device and behavior. Tracks the visitor across devices and marketing channels. Expiry: 1 dayType: HTTP IDEPending Expiry: 1 yearType: HTTP ads/ga-audiencesPending Expiry: SessionType: Pixel NIDPending Expiry: 6 monthsType: HTTP pagead/1p-user-list/#Pending Expiry: SessionType: Pixel collectUsed to send data to Google Analytics about the visitor's device and behavior. Tracks the visitor across devices and marketing channels. Expiry: SessionType: Pixel csiCollects data on visitors' preferences and behaviour on the website - This information is used make content and advertisement more relevant to the specific visitor. Expiry: SessionType: Pixel * Klaviyo 1 Learn more about this provider __kla_viewedCollects information on the user's website navigation and preferences - This is used to target potential newsletter based upon this information. Expiry: PersistentType: HTML * Microsoft 10 Learn more about this provider _uetsidUsed to track visitors on multiple websites, in order to present relevant advertisement based on the visitor's preferences. Expiry: PersistentType: HTML _uetsid_expContains the expiry-date for the cookie with corresponding name. Expiry: PersistentType: HTML _uetvidUsed to track visitors on multiple websites, in order to present relevant advertisement based on the visitor's preferences. Expiry: PersistentType: HTML _uetvid_expContains the expiry-date for the cookie with corresponding name. Expiry: PersistentType: HTML MSPTCThis cookie registers data on the visitor. The information is used to optimize advertisement relevance. Expiry: 1 yearType: HTTP MUIDPending Expiry: 1 yearType: HTTP _uetsid [x2]Collects data on visitor behaviour from multiple websites, in order to present more relevant advertisement - This also allows the website to limit the number of times that they are shown the same advertisement. Expiry: 1 dayType: HTTP _uetvid [x2]Used to track visitors on multiple websites, in order to present relevant advertisement based on the visitor's preferences. Expiry: SessionType: HTTP * Mouseflow 1 Learn more about this provider mf_#Collects data of the user's navigation and interaction on the website in order to personalise the purchasing experience. Expiry: 3 monthsType: HTTP * Pinterest 4 Learn more about this provider _pin_unauthUsed by Pinterest to track the usage of services. Expiry: 1 yearType: HTTP _pinterest_ct_uaUsed by Pinterest to track the usage of services. Expiry: 1 yearType: HTTP ar_debugPending Expiry: 1 yearType: HTTP v3/Used by Pinterest to track the usage of services. Expiry: SessionType: Pixel * Reddit 4 Learn more about this provider rp.gifNecessary for the implementation of the Reddit.com's share-button function. Expiry: SessionType: Pixel _rdt_uuid [x3]Used to track visitors on multiple websites, in order to present relevant advertisement based on the visitor's preferences. Expiry: 3 monthsType: HTTP * YouTube 23 Learn more about this provider #-#Pending Expiry: SessionType: HTML -4f9fb3a80c841Pending Expiry: SessionType: HTML iU5q-!O9@$Registers a unique ID to keep statistics of what videos from YouTube the user has seen. Expiry: SessionType: HTML LAST_RESULT_ENTRY_KEYUsed to track user’s interaction with embedded content. Expiry: SessionType: HTTP LogsDatabaseV2:V#||LogsRequestsStorePending Expiry: PersistentType: IDB nextIdUsed to track user’s interaction with embedded content. Expiry: SessionType: HTTP remote_sidNecessary for the implementation and functionality of YouTube video-content on the website. Expiry: SessionType: HTTP requestsUsed to track user’s interaction with embedded content. Expiry: SessionType: HTTP ServiceWorkerLogsDatabase#SWHealthLogNecessary for the implementation and functionality of YouTube video-content on the website. Expiry: PersistentType: IDB VISITOR_INFO1_LIVEPending Expiry: 180 daysType: HTTP VISITOR_PRIVACY_METADATAStores the user's cookie consent state for the current domain Expiry: 180 daysType: HTTP YSCPending Expiry: SessionType: HTTP yt.innertube::nextIdRegisters a unique ID to keep statistics of what videos from YouTube the user has seen. Expiry: PersistentType: HTML yt.innertube::requestsRegisters a unique ID to keep statistics of what videos from YouTube the user has seen. Expiry: PersistentType: HTML ytidb::LAST_RESULT_ENTRY_KEYUsed to track user’s interaction with embedded content. Expiry: PersistentType: HTML YtIdbMeta#databasesUsed to track user’s interaction with embedded content. Expiry: PersistentType: IDB yt-remote-cast-availableStores the user's video player preferences using embedded YouTube video Expiry: SessionType: HTML yt-remote-cast-installedStores the user's video player preferences using embedded YouTube video Expiry: SessionType: HTML yt-remote-connected-devicesStores the user's video player preferences using embedded YouTube video Expiry: PersistentType: HTML yt-remote-device-idStores the user's video player preferences using embedded YouTube video Expiry: PersistentType: HTML yt-remote-fast-check-periodStores the user's video player preferences using embedded YouTube video Expiry: SessionType: HTML yt-remote-session-appStores the user's video player preferences using embedded YouTube video Expiry: SessionType: HTML yt-remote-session-nameStores the user's video player preferences using embedded YouTube video Expiry: SessionType: HTML * cdn.noibu.com 1 n_browser_dataTracks the conversion rate between the user and the advertisement banners on the website - This serves to optimise the relevance of the advertisements on the website. Expiry: PersistentType: HTML * www.google.com www.youtube.com 2 TESTCOOKIESENABLED [x2]Used to track user’s interaction with embedded content. Expiry: 1 dayType: HTTP * Unclassified 25 Unclassified cookies are cookies that we are in the process of classifying, together with the providers of individual cookies. * Live HelpNow! 4 Learn more about this provider lhnContactPending Expiry: 2 yearsType: HTTP lhnJWTPending Expiry: 1 dayType: HTTP lhnRefreshPending Expiry: 4 daysType: HTTP lhnStorageTypePending Expiry: 1 dayType: HTTP * Youth Discount 1 Learn more about this provider _youthdiscount_sessionPending Expiry: SessionType: HTTP * herringshoes.co.uk 1 recentViewsPending Expiry: 1 yearType: HTTP * herringshoes.co.uk www.herringshoes.co.uk 4 bfok [x2]Pending Expiry: SessionType: HTTP presale [x2]Pending Expiry: SessionType: HTTP * lantern.roeyecdn.com 1 lanternPending Expiry: 30 daysType: HTTP * live.conferwith.io 10 __ph_opt_in_out_phc_znhKsTzpZvbSbxQyrnbV5sffoNJoivbxYC4MUhJeaTCPending Expiry: SessionType: HTTP ph_#_posthog [x2]Pending Expiry: 1 yearType: HTTP currentProductURLPending Expiry: SessionType: HTML customerInfoPending Expiry: PersistentType: HTML FEATURE_FLAGPending Expiry: SessionType: HTML ph_#_primary_window_existsPending Expiry: SessionType: HTML ph_#_window_idPending Expiry: SessionType: HTML PUBLIC_DATAPending Expiry: SessionType: HTML serverUrlPending Expiry: PersistentType: HTML * senior.discount 1 _seniordiscount_sessionPending Expiry: SessionType: HTTP * www.dwin1.com 2 track.phpPending Expiry: SessionType: Pixel 23568_lanternPending Expiry: 6 monthsType: HTTP * www.herringshoes.co.uk 1 forceDesktopPending Expiry: 30 daysType: HTTP Cross-domain consent[#BULK_CONSENT_DOMAINS_COUNT#] [#BULK_CONSENT_TITLE#] List of domains your consent applies to: [#BULK_CONSENT_DOMAINS#] Cookie declaration last updated on 26/02/2024 by Cookiebot [#IABV2_TITLE#] [#IABV2_BODY_INTRO#] [#IABV2_BODY_LEGITIMATE_INTEREST_INTRO#] [#IABV2_BODY_PREFERENCE_INTRO#] [#IABV2_LABEL_PURPOSES#] [#IABV2_BODY_PURPOSES_INTRO#] [#IABV2_BODY_PURPOSES#] [#IABV2_LABEL_FEATURES#] [#IABV2_BODY_FEATURES_INTRO#] [#IABV2_BODY_FEATURES#] [#IABV2_LABEL_PARTNERS#] [#IABV2_BODY_PARTNERS_INTRO#] [#IABV2_BODY_PARTNERS#] Cookies are small text files that can be used by websites to make a user's experience more efficient. The law states that we can store cookies on your device if they are strictly necessary for the operation of this site. For all other types of cookies we need your permission. This site uses different types of cookies. Some cookies are placed by third party services that appear on our pages. You can at any time change or withdraw your consent from the Cookie Declaration on our website. Learn more about who we are, how you can contact us and how we process personal data in our Privacy Policy. Please state your consent ID and date when you contact us regarding your consent. Do not sell or share my personal information Deny Allow selection Customize Allow all Powered by Cookiebot by Usercentrics FREE shipping for full price orders over £150 to GB Log in | Help | Wishlist | Basket 0 items Brands View AllMen's by PopularityMen's by NameWomen's by PopularityLatest BrandsTrending Now:SaleHerringLoakeBarkerTricker'sChurch'sCarlos SantosCheaneyRM WilliamsRed WingSaphirSebagoAigleWildsmithPeregrineTanner BatesAigleBarkerCarlos SantosCheaneyChurch'sHerringLoakePeregrineRM WilliamsRed WingSaphirSebagoTanner BatesTricker'sWildsmithHerring LadiesRed Wing LadiesAigle LadiesSebago LadiesAllen EdmondsNPSRed WingRM Williams ON OUR JOURNAL: THE BARCELONA ON OUR JOURNAL: ENDURING PEAKY STYLE STARTS AT YOUR FEET ON OUR JOURNAL: THE SUIT IS BACK…SO ARE FORMAL SHOES! Men View AllBrandsFormal StylesCasual StylesShoe CareAccessoriesLuggageClothingNewSaleHerringLoakeBarkerTricker'sChurch'sCarlos SantosCheaneyRM WilliamsRed WingSaphirSebagoAigleWildsmithPeregrineTanner BatesFormal StylesBroguesSemi-BroguesOxfordsToe-capLoaferMonk StrapWholecutPlainTwo-ToneBootsCasual StylesTrainersSneakersDeck shoesDriving MoccasinsSlippersAll Shoe CareValet BoxesClothsBrushesShoe treesPolishes, creams and cleanersSaphirThe History of LeatherAll AccessoriesSocksBeltsBracesHatsScarvesTiesBriefcasesMan BagsWeekend BagsAll ClothingShirtsJacketsScarvesPeregrine clothing Women View AllBrandsStyleShoe CareLuggageNewGiftsSaleHerring LadiesRed Wing LadiesAigle LadiesSebago LadiesAll StylesShoesBootsLoafersAll Shoe CareValet BoxesClothsBrushesShoe treesPolishes, creams and cleanersSaphirThe History of LeatherAll LuggageBriefcasesSmall Bags Styles View AllShoesBootsCasual StylesView All ShoesView All BootsSaleFormal StylesBroguesSemi-BroguesOxfordsToe-capLoaferMonk StrapWholecutPlainTwo-ToneBootsBroguesSemi-BroguesToe-capPlain FrontChelseaJohdpurCasual StylesTrainersSneakersDeck shoesDriving MoccasinsSlippers Luggage View AllLuggageBusinessHolidayTrending NowNewSaleAll LuggageBriefcasesSmall BagsWeekend BagsBriefcasesSuit CarriersHoldallsWashbags ON OUR JOURNAL: TRAVEL IN STYLE WITH GORGEOUS LEATHER LUGGAGE Clothing View AllClothingAccessoriesNewClothing saleAll ClothingShirtsJacketsScarvesPeregrine clothingAll AccessoriesSocksBeltsBracesHatsScarvesTies Shoe Care View AllShoe CareTrending NowVideosNewSaleAll Shoe CareValet BoxesClothsBrushesShoe treesPolishes, creams and cleanersSaphirThe History of Leather ON OUR JOURNAL: A DETAILED SHOE CARE GUIDE ON OUR JOURNAL: WOODEN SHOE TREES ARE ESSENTIAL POLISHING SHOES PART 1 POLISHING SHOES PART 2 - HI-SHINE Journal Our JournalLook Who's Wearing HerringSocial ON OUR JOURNAL: THE BARCELONA ON OUR JOURNAL: ENDURING PEAKY STYLE STARTS AT YOUR FEET ON OUR JOURNAL: THE SUIT IS BACK…SO ARE FORMAL SHOES! View all 62 profilesSir Geoff Hurst MBETheo PaphitisWill Carling OBECharley BoormanGareth Malone OBECharlie BrownAlex Gregory MBEMichael Caines, MBEMax McMurdoDavid FlatmanIan Wright MBECurtis StigersMarcus Trescothick MBESimon Weston CBEGreg Whyte OBEJohn HaggerFacebookTwitterYoutube Help About UsHelpSustainabilityPrivacyTermsFAQShippingReturnsContact UsStudent & 16-26 DiscountSenior Discount 55+ Sale By Men's BrandBy Women's BrandAll SaleHerring saleLoake saleBarker saleTricker's saleChurch's saleCarlos Santos saleCheaney saleMoreschi saleRed Wing saleSebago saleSperry saleAigle saleWildsmith saleHerring Ladies saleBarker Ladies saleRed Wing Ladies saleSebago Ladies saleMen's SaleLadies' SaleLuggage SaleShoe Care SaleClothing Sale Close Shipping to: -- Delivery Country --------------UNITED KINGDOMUNITED STATESGERMANYAUSTRALIASWITZERLANDFRANCEREPUBLIC OF IRELANDSINGAPOREHONG KONGITALYAFGHANISTANALAND ISLANDSALBANIAALGERIAAMERICAN SAMOAANDORRAANGOLAANGUILLAANTARCTICAANTIGUA AND BARBUDAARGENTINAARMENIAARUBAAUSTRALIAAUSTRIAAZERBAIJANBAHAMASBAHRAINBALTIC STATESBANGLADESHBARBADOSBELARUSBELGIUMBELIZEBENINBERMUDABFPOBHUTANBOLIVIABONAIRE, SEBBOSNIABOTSWANABOUVET ISLANDBRAZILBRITISH INDIAN OCEAN TERRITORYBRUNEIBULGARIABURKINA FASOBURUNDICAMBODIACAMEROONCANADACAPE VERDECAYMAN ISLANDSCENTRAL AFRICAN REPUBLICCHADCHILECHINACHRISTMAS ISLANDCOCOS (KEELING) ISLANDSCOLOMBIACOMOROSCONGOCONGO, DRCOOK ISLANDSCOSTA RICACOTE D'IVOIRECROATIACUBACURACAOCYPRUSCZECH REPUBLICDENMARKDJIBOUTIDOMINICADOMINICAN REPUBLICECUADOREGYPTEL SALVADOREQUATORIAL GUINEAERITREAESTONIAETHIOPIAFALKLAND ISLANDSFAROE ISLANDSFIJIFINLANDFRANCEFRENCH GUIANAFRENCH POLYNESIAFRENCH SOUTHERN TERRITORIESGABONGAMBIAGEORGIAGERMANYGHANAGIBRALTARGRAN CANARIAGREECEGREENLANDGRENADAGUADELOUPEGUAMGUATEMALAGUERNSEYGUINEAGUINEA-BISSAUGUYANAHAITIHEARD ISLAND MIHONDURASHONG KONGHUNGARYICELANDINDIAINDONESIAIRANIRAQISLE OF MANISRAELITALYJAMAICAJAPANJERSEYJORDANKAZAKHSTANKENYAKIRIBATIKOREA (South)KUWAITKYRGYZSTANLAOSLATVIALEBANONLESOTHOLIBERIALIBYALIECHTENSTEINLITHUANIALUXEMBOURGMACAOMACEDONIA, FYRMADAGASCARMALAWIMALAYSIAMALDIVESMALIMALTAMARSHALL ISLANDSMARTINIQUEMAURITANIAMAURITIUSMAYOTTEMEXICOMICRONESIA, FSMOLDOVAMONACOMONGOLIAMONTENEGROMONTSERRATMOROCCOMOZAMBIQUEMYANMARNAMIBIANAURUNEPALNETHERLANDSNEW CALEDONIANEW ZEALANDNICARAGUANIGERNIGERIANIUENORFOLK ISLANDNORTHERN MARIANA ISLANDSNORWAYOMANPAKISTANPALAUPALESTINE, STATE OFPANAMAPAPUA NEW GUINEAPARAGUAYPERUPHILIPPINESPITCAIRNPOLANDPORTUGALPUERTO RICOQATARREPUBLIC OF IRELANDREUNIONROMANIARUSSIARWANDASAINT BARTHELEMYSAINT HELENA, ATDCSAINT LUCIASAINT MARTIN FPSAINT PIERRE AND MIQUELONSAINT VINCENT TGSAMOASAN MARINOSAO TOME AND PRINCIPESAUDI ARABIASENEGALSERBIASEYCHELLESSIERRA LEONESINGAPORESINT MAARTEN DPSLOVAKIASLOVENIASOLOMON ISLANDSSOMALIASOUTH AFRICASOUTH GEORGIA TSSISOUTH SUDANSPAINSRI LANKAST. KITTS AND NEVISSUDANSURINAMESVALBARD AND JAN MAYENSWAZILANDSWEDENSWITZERLANDSYRIAN ARAB REPUBLICTAIWANTAJIKISTANTANZANIATHAILANDTIMOR-LESTETOGOTOKELAUTONGATRINIDAD AND TOBAGOTUNISIATURKEYTURKS AND CAICOS ISLANDSTUVALUUGANDAUKRAINEUNITED ARAB EMIRATESUNITED KINGDOMUNITED STATESURUGUAYUS MINOR OUTLYING ISLANDSUZBEKISTANVANUATUVATICAN CITYVENEZUELAVIETNAMVIRGIN ISLANDS, BRITISHVIRGIN ISLANDS, USWALLIS AND FUTUNAWEST INDIESWESTERN SAHARAYEMENZAMBIAZIMBABWE Remember my country: How do you use my country information? Shop: ShoesClothingLuggage I'M LOOKING FOR... style: any styleOxfordsOxfords with toe capBroguesSemi-broguesLoafersMonk shoesDouble monksBootsSpectator/Two-toneDeck shoesDriving moccasinsSneakersTrainersSlippersDerby/Gibson colour: any colourBlackBrown & tanBurgundyBlueGreenRedWhiteOther coloursGrey size: any sizeUK 4 (Eur 38 / US 4.5)UK 5 (Eur 39 / US 6)UK 5.5 (Eur 39.5 / US 6.5)UK 6 (Eur 40 / US 7)UK 6.5 (Eur 40.5 / US 7.5)UK 7 (Eur 41 / US 8)UK 7.5 (Eur 41.5 / US 8.5)UK 8 (Eur 42 / US 9)UK 8.5 (Eur 42.5 / US 9.5)UK 9 (Eur 43 / US 10)UK 9.5 (Eur 43.5 / US 10.5)UK 10 (Eur 44 / US 11)UK 10.5 (Eur 44.5 / US 11.5)UK 11 (Eur 45 / US 12)UK 11.5 (Eur 45.5 / US 12.5)UK 12 (Eur 46 / US 13)UK 12.5 (Eur 46.5 / US 13.5)UK 13 (Eur 47 / US 14)UK 13.5 (Eur 47.5 / US 14.5)UK 14 (Eur 48 / US 15)UK 15 (Eur 49 / US 16) fit: any fitE - NarrowF - MediumG - WideH - Very WideD - Very Narrow full price sale available in stock Herring Shoes https://assets.herringshoes.co.uk/images/design/herring_shoes_logo.png Herring Shoes Ltd, Unit 6, Old Station Yard, Kingsbridge, Devon, TQ7 1ES, UNITED KINGDOM +441548854886 https://www.herringshoes.co.uk is rated 4.9 out of 5 from 9184 reviews Google Customer Reviews Stay updated! Sign up to get email updates about exclusive sales, new collections and styling tips. What content would you like to hear about? Men's Women's Everything Sign up By submitting the form, you agree to receive marketing emails from Herring Shoes. You can opt out at anytime by clicking the unsubscribe link in the email. View Privacy Policy. QUICK LINKS Men's Suede Oxford Shoes Men's Spectator Shoes Men's Semi-brogues Men's Slippers Men's Slippers Herring Shoe Care Herring Luggage Herring Belts HERRING Home Contact Us About Us Look Who's Wearing Testimonials New styles Best sellers Gift vouchers Help ID HELP Shoe Style Guide Shoe Care Guide Last Shape Guide Help/FAQ Price promise Tax Calculator Shipping Information Returns Policy Terms & Conditions Privacy policy Sustainability Student & 16-26 Discount Senior Discount 55+ BRANDS Herring Wildsmith About Church shoes Barker Loake Cheaney Trickers Saphir Leather Milk Carlos Santos Sebago Red Wing CATEGORIES Men's Suede Chelsea Boots Brown Double Monks Black Brogues Black Oxford Shoes Men's Oxford Shoes Herring Shoe Care Herring Luggage Herring Belts SOCIAL Facebook Twitter Youtube Our blog Instagram LinkedIn PAY USING Offline Video chat with our team before you buy Home SearchMen's SaleLadies' SaleAccessories Sale Shoes and bootsMens stylesLadies' stylesBroguesOxfordsMonk shoesBoots HerringShoes & bootsClothing & BeltsLuggageSocksShoe careGift vouchers BrandsHerringWildsmithChurchBarkerLoakeCheaneyTricker'sSebagoCarlos SantosRed Wing MensRed Wing LadiesRM WilliamsAllen EdmondsNPSNPS LadiesPeregrineMoreschiSperryAigle Shipping & currency New stylesHelp/FAQShipping/ReturnsJournalContactAboutPrivacySustainabilityYouth DiscountSenior DiscountLog in Desktop siteHelp ID word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word mmMwWLliI0fiflO&1 mmMwWLliI0fiflO&1 mmMwWLliI0fiflO&1 mmMwWLliI0fiflO&1 mmMwWLliI0fiflO&1 mmMwWLliI0fiflO&1 mmMwWLliI0fiflO&1 Close dialog 1 Unlock 10% off your first order* Sign up to get email updates about exclusive sales, new collections and styling tips. Add your phone number if you want to get an occasional text about our sales. What content would you like to hear about? Male Female Everything Unlock Offer By submitting this form and signing up to receive marketing emails from Herring Shoes. Unsubscribe at any time by clicking the unsubscribe link in the emails. View Privacy Policy. *Discount only applies to full-priced items. Sale items not included. New customers only. No, thanks CONVERSATION CONNECTING TO AGENT * Chat * Ticket