www.devaniux.com
Open in
urlscan Pro
54.154.42.22
Public Scan
Submitted URL: http://www.devaniux.com/
Effective URL: https://www.devaniux.com/
Submission: On December 05 via api from US — Scanned from US
Effective URL: https://www.devaniux.com/
Submission: On December 05 via api from US — Scanned from US
Form analysis
1 forms found in the DOMGET https://www.devaniux.com/index.aspx?pageid=AzwKl
<form action="https://www.devaniux.com/index.aspx?pageid=AzwKl" method="get"><input name="pageid" id="pageid" type="hidden" value="AzwKl"><input name="chainID" id="chainID" type="hidden" value="846272">
<div class="search" data-editor-type="search">
<div class="search_container">
<input type="text" id="txtQuickSearch" name="txtQuickSearch" placeholder="search" aria-label="product search">
<button aria-label="search"><i class="fas fa-search" aria-hidden="true"></i></button>
<div id="search_container_close"><i class="fas fa-times" aria-hidden="true"></i></div>
</div>
</div>
</form>
Text Content
www.devaniux.com/sitemap.aspx?shopkeeper=846272 Product Added to your Cart x proceed to checkout -------- OR -------- continue shopping continue shopping EUR AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL Menu HomeAboutCommission InfoSocialsContactCartReviews Store 🖤 Themes🖤 Art Prints🖤 Digital Downloads🖤 Keychains🖤 Pin Buttons🖤 Stickers🖤 Sticker Sheets🖤 Sticker Sets🌙 PRE-ORDER 🌙💓 SALE! 💓💜 VIEW ALL Welcome to Devaniux Sign In EUR AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL HomeAboutCommission InfoSocialsContactCartReviews Store 🖤 Themes🖤 Art Prints🖤 Digital Downloads🖤 Keychains🖤 Pin Buttons🖤 Stickers🖤 Sticker Sheets🖤 Sticker Sets🌙 PRE-ORDER 🌙💓 SALE! 💓💜 VIEW ALL 0 0,00 € * * * < * > Welcome to my online store! As some of you already know, I am Devaniux and I'm a digital artist from Belgium, Europe! I made my this online shop to sell all of my works (including fanmade ones) since I found Etsy too much when it comes to their fees. In my shop all the fees are included in the total price so no need to worry about extra fee costs! ♥ ko-fi.com/devaniux/tiers ♥ Big shout-out to my amazing Ko-fi supporters! ♥ Bowler4Ever ♥ Thot ♥ darkpersona26 ♥ Chichi ♥  Featured Products Devaniux Genshin Impact - Raiden Shogun | 38 mm 2,00 € Add To Cart Devaniux POKEMON (GEN 1) - #007-#009 - Squirtle, Wartortle, Blastoise | Button 38 m m 2,00 € Add To Cart Devaniux POKEMON (GEN 1) - #004-#006 - Charmander, Charmeleon, Charizard | Button 38 m m 2,00 € Add To Cart Devaniux POKEMON (GEN 1) - #001-#003 - Bulbasaur, Ivysaur, Venusaur | Button 38 m m 2,00 € Add To Cart Devaniux Genshin Impact - Fischl | 38 mm 2,00 € Add To Cart Devaniux Genshin Impact - Dainsleif | 38 mm 2,00 € Add To Cart Devaniux Genshin Impact - Kamisato Ayato | 38 mm 2,00 € Add To Cart Devaniux POKEMON (GEN 1) - #129-#130 - Magikarp, Gyarados | Button 38 m m 2,00 € Add To Cart Devaniux POKEMON (GEN 1) - #25-#26 - Pikachu, Raichu | Button 38 m m 2,00 € Add To Cart Devaniux POKEMON (GEN 2)- #172 - Pichu | Button 38 m m 2,00 € Add To Cart Devaniux POKEMON (GEN 2) - #152-#154 - Chikorita, Bayleef, Meganium | Button 38 m m 2,00 € Add To Cart Devaniux POKEMON (GEN 2) - #155-#157 Cyndaquil, Quilava, Typhlosion | Button 38 m m 2,00 € Add To Cart Devaniux POKEMON (GEN 2) - #158-#160 Totodile, Croconaw, Feraligatr | Button 38 m m 2,00 € Add To Cart Devaniux POKEMON: Eeveelutions 2,00 € Add To Cart Devaniux Atem (2019) | A5-A4 Print 7,00 € Add To Cart Devaniux Happy Birthday, Yugi | A4 Print 9,00 € Add To Cart Devaniux DUEL SERIES: Jonouchi Shizuka | BUTTON 38 mm/1.5 inch 1,90 € Add To Cart Devaniux DUEL SERIES: Kujaku Mai | BUTTON 38 mm/1.5 inch 1,90 € Add To Cart Devaniux POKEMON: SALE | Button 38 mm 2,00 € 1,20 € 40% Add To Cart Devaniux YUGIOH: 'Halloween:' Yami Yugi, Kaiba, Yami Bakura | BUTTON 38 mm/1.5 inch 1,90 € Add To Cart Devaniux GENSHIN IMPACT: 'Halloween' Childe, Zhongli, Venti, Keqing | BUTTON 38 mm / 1.5 inch 1,90 € Add To Cart Devaniux POKEMON: Ghastly, Haunter, Gengar | BUTTON 38 mm / 1.5 inch 1,90 € Add To Cart Devaniux YUGIOH: 'Lost Life' | A4 Print (8" x 11") 13,00 € Add To Cart Devaniux MYSTERY BAG - YGO theme 7,00 € Add To Cart Devaniux B.LACK - Cover | A4 Print 9,00 € Add To Cart Devaniux Dottore - Shush | A4 Print 9,00 € Add To Cart Devaniux Alhaitham - Scatter | A4 Print 12,00 € Add To Cart Devaniux Gengar - Sitting | Sticker 2" - 6cm 3,50 € Add To Cart Devaniux Mimikyu | Sticker 2" - 6cm 3,50 € Add To Cart Devaniux Ho-Oh & Lugia - Keychains 12,00 € Add To Cart Devaniux Eevee - Sitting | Sticker 2" - 6cm 3,50 € Add To Cart Devaniux Genshin Impact - Primogems | Sticker Set 7,00 € Add To Cart Devaniux StickerSheet | Yugioh Classic - Yami Bakura 8,00 € Add To Cart Devaniux StickerSheet | Yugioh Classic - Yami Yugi 8,00 € Add To Cart Devaniux StickerSheet | Yugioh Classic - Kaiba Seto 8,00 € Add To Cart Devaniux Mimikyu - Set 01 | Sticker Emotes 13,00 € Add To Cart Devaniux Genshin Impact | 'Neko Costume' - Neuvillette | 2" - 5cm 3,00 € Add To Cart Devaniux Genshin Impact | 'Neko Costume' - Nahida | 2" - 5cm 3,00 € Add To Cart Devaniux Genshin Impact | 'Neko Costume' - Cyno | 2" - 5cm 3,00 € Add To Cart Devaniux Genshin Impact | 'Neko Costume' - Tartaglia | 2" - 5cm 3,00 € Add To Cart Devaniux Genshin Impact | 'Cherish Series'- Dottore | 2" - 5cm 3,00 € Add To Cart Devaniux Pokemon - Zeraora Sticker | 2.5" - 6.5cm 3,50 € Add To Cart Devaniux Pokemon - Lucario Sticker | 2.5" - 6.5cm 3,50 € Add To Cart Devaniux YuGiOh! Stickers - Suwaru Set 3,50 € Add To Cart Devaniux Keychain | Genshin Impact - Kazuha 8,00 € Add To Cart Devaniux Honkai Star Rail - SET 1 | 59mm 2,50 € Add To Cart Devaniux Genshin Impact - Raiden Shogun | 38 mm 2,00 € Add To Cart Devaniux POKEMON (GEN 1) - #007-#009 - Squirtle, Wartortle, Blastoise | Button 38 m m 2,00 € Add To Cart Devaniux POKEMON (GEN 1) - #004-#006 - Charmander, Charmeleon, Charizard | Button 38 m m 2,00 € Add To Cart Devaniux POKEMON (GEN 1) - #001-#003 - Bulbasaur, Ivysaur, Venusaur | Button 38 m m 2,00 € Add To Cart Devaniux Genshin Impact - Fischl | 38 mm 2,00 € Add To Cart Devaniux Genshin Impact - Dainsleif | 38 mm 2,00 € Add To Cart Devaniux Genshin Impact - Kamisato Ayato | 38 mm 2,00 € Add To Cart Devaniux POKEMON (GEN 1) - #129-#130 - Magikarp, Gyarados | Button 38 m m 2,00 € Add To Cart Devaniux POKEMON (GEN 1) - #25-#26 - Pikachu, Raichu | Button 38 m m 2,00 € Add To Cart Devaniux POKEMON (GEN 2)- #172 - Pichu | Button 38 m m 2,00 € Add To Cart Devaniux POKEMON (GEN 2) - #152-#154 - Chikorita, Bayleef, Meganium | Button 38 m m 2,00 € Add To Cart Devaniux POKEMON (GEN 2) - #155-#157 Cyndaquil, Quilava, Typhlosion | Button 38 m m 2,00 € Add To Cart Devaniux POKEMON (GEN 2) - #158-#160 Totodile, Croconaw, Feraligatr | Button 38 m m 2,00 € Add To Cart Devaniux POKEMON: Eeveelutions 2,00 € Add To Cart Devaniux Atem (2019) | A5-A4 Print 7,00 € Add To Cart Devaniux Happy Birthday, Yugi | A4 Print 9,00 € Add To Cart Devaniux DUEL SERIES: Jonouchi Shizuka | BUTTON 38 mm/1.5 inch 1,90 € Add To Cart Devaniux DUEL SERIES: Kujaku Mai | BUTTON 38 mm/1.5 inch 1,90 € Add To Cart Devaniux POKEMON: SALE | Button 38 mm 2,00 € 1,20 € 40% Add To Cart Devaniux YUGIOH: 'Halloween:' Yami Yugi, Kaiba, Yami Bakura | BUTTON 38 mm/1.5 inch 1,90 € Add To Cart Devaniux GENSHIN IMPACT: 'Halloween' Childe, Zhongli, Venti, Keqing | BUTTON 38 mm / 1.5 inch 1,90 € Add To Cart Devaniux POKEMON: Ghastly, Haunter, Gengar | BUTTON 38 mm / 1.5 inch 1,90 € Add To Cart Devaniux YUGIOH: 'Lost Life' | A4 Print (8" x 11") 13,00 € Add To Cart Devaniux MYSTERY BAG - YGO theme 7,00 € Add To Cart Devaniux B.LACK - Cover | A4 Print 9,00 € Add To Cart Devaniux Dottore - Shush | A4 Print 9,00 € Add To Cart Devaniux Alhaitham - Scatter | A4 Print 12,00 € Add To Cart Devaniux Gengar - Sitting | Sticker 2" - 6cm 3,50 € Add To Cart Devaniux Mimikyu | Sticker 2" - 6cm 3,50 € Add To Cart Devaniux Ho-Oh & Lugia - Keychains 12,00 € Add To Cart Devaniux Eevee - Sitting | Sticker 2" - 6cm 3,50 € Add To Cart Devaniux Genshin Impact - Primogems | Sticker Set 7,00 € Add To Cart Devaniux StickerSheet | Yugioh Classic - Yami Bakura 8,00 € Add To Cart Devaniux StickerSheet | Yugioh Classic - Yami Yugi 8,00 € Add To Cart Devaniux StickerSheet | Yugioh Classic - Kaiba Seto 8,00 € Add To Cart Devaniux Mimikyu - Set 01 | Sticker Emotes 13,00 € Add To Cart Devaniux Genshin Impact | 'Neko Costume' - Neuvillette | 2" - 5cm 3,00 € Add To Cart Devaniux Genshin Impact | 'Neko Costume' - Nahida | 2" - 5cm 3,00 € Add To Cart Devaniux Genshin Impact | 'Neko Costume' - Cyno | 2" - 5cm 3,00 € Add To Cart Devaniux Genshin Impact | 'Neko Costume' - Tartaglia | 2" - 5cm 3,00 € Add To Cart Devaniux Genshin Impact | 'Cherish Series'- Dottore | 2" - 5cm 3,00 € Add To Cart Devaniux Pokemon - Zeraora Sticker | 2.5" - 6.5cm 3,50 € Add To Cart Devaniux Pokemon - Lucario Sticker | 2.5" - 6.5cm 3,50 € Add To Cart Devaniux YuGiOh! Stickers - Suwaru Set 3,50 € Add To Cart Devaniux Keychain | Genshin Impact - Kazuha 8,00 € Add To Cart Devaniux Honkai Star Rail - SET 1 | 59mm 2,50 € Add To Cart Popular Categories 🖤 Art Prints View 🖤 Keychains View 🖤 Themes View 🖤 Sticker Sets View 🖤 Stickers View 🖤 Pin Buttons View 🖤 Sticker Sheets View New Products Devaniux Pokemon - Zeraora Sticker | 2.5" - 6.5cm 3,50 € Add To Cart Devaniux Pokemon - Lucario Sticker | 2.5" - 6.5cm 3,50 € Add To Cart Devaniux YuGiOh! Stickers - Suwaru Set 3,50 € Add To Cart Devaniux Honkai Star Rail - Blade | 59mm 2,50 € Add To Cart Devaniux Honkai Star Rail - Stelle | 59mm 2,50 € Add To Cart Devaniux Honkai Star Rail - Caelus | 59mm 2,50 € Add To Cart Devaniux Keychain | Genshin Impact - Kazuha 8,00 € Add To Cart Devaniux Chibi Thief King Bakura | A6 Print 5,00 € Add To Cart Devaniux Genshin Impact - Stickers | 10cm 4,50 € Add To Cart Devaniux Honkai Star Rail - SET 1 | 59mm 2,50 € Add To Cart Devaniux POKEMON Holo Buttons Set | Button 59mm 2,00 € Add To Cart Devaniux Genshin Impact - Yae Miko | 38 mm 2,00 € Add To Cart Devaniux Genshin Impact - Venti | 38 mm 2,00 € Add To Cart Devaniux Genshin Impact - Tartaglia | 38 mm 2,00 € Add To Cart Devaniux Genshin Impact - Sucrose | 38 mm 2,00 € Add To Cart Devaniux Genshin Impact - Rosaria | 38 mm 2,00 € Add To Cart Devaniux Genshin Impact - Razor | 38 mm 2,00 € Add To Cart Devaniux Genshin Impact - Raiden Shogun | 38 mm 2,00 € Add To Cart Devaniux Genshin Impact - Nahida | 38 mm 2,00 € Add To Cart Devaniux Genshin Impact - Mika | 38 mm 2,00 € Add To Cart Devaniux Genshin Impact - Lisa | 38 mm 2,00 € Add To Cart Devaniux Genshin Impact - Klee | 38 mm 2,00 € Add To Cart Devaniux YUGIOH: Millennium Items | BUTTON 38 mm/1.5 inch 2,10 € 1,26 € 40% Add To Cart Devaniux POKEMON (GEN 1) - #007-#009 - Squirtle, Wartortle, Blastoise | Button 38 m m 2,00 € Add To Cart Devaniux MYSTERY BAG - YGO theme 7,00 € Add To Cart Devaniux B.LACK - Cover | A4 Print 9,00 € Add To Cart Devaniux Dottore - Shush | A4 Print 9,00 € Add To Cart Devaniux Alhaitham - Scatter | A4 Print 12,00 € Add To Cart Devaniux Chibi Thief King Bakura | A6 Print 5,00 € Add To Cart Devaniux KIRAKIRA - Genshin Impact Keychain: Tighnari 12,00 € Add To Cart Devaniux KIRAKIRA - Genshin Impact Keychain: Childe 12,00 € Add To Cart Devaniux KIRAKIRA - Genshin Impact Keychain: Dottore 12,00 € Add To Cart Devaniux KIRAKIRA - Genshin Impact Keychain: Cyno 12,00 € Add To Cart Devaniux Gengar - Sitting | Sticker 2" - 6cm 3,50 € Add To Cart Devaniux Mimikyu | Sticker 2" - 6cm 3,50 € Add To Cart Devaniux Ho-Oh & Lugia - Keychains 12,00 € Add To Cart Devaniux Eevee - Sitting | Sticker 2" - 6cm 3,50 € Add To Cart Devaniux Genshin Impact - Primogems | Sticker Set 7,00 € Add To Cart Devaniux StickerSheet | Yugioh Classic - Yami Bakura 8,00 € Add To Cart Devaniux StickerSheet | Yugioh Classic - Yami Yugi 8,00 € Add To Cart Devaniux StickerSheet | Yugioh Classic - Kaiba Seto 8,00 € Add To Cart Devaniux Mimikyu - Set 01 | Sticker Emotes 13,00 € Add To Cart Devaniux Genshin Impact | 'Neko Costume' - Neuvillette | 2" - 5cm 3,00 € Add To Cart Devaniux Genshin Impact | 'Neko Costume' - Nahida | 2" - 5cm 3,00 € Add To Cart Devaniux Genshin Impact | 'Neko Costume' - Cyno | 2" - 5cm 3,00 € Add To Cart Devaniux Genshin Impact | 'Neko Costume' - Tartaglia | 2" - 5cm 3,00 € Add To Cart Devaniux Genshin Impact | 'Cherish Series'- Dottore | 2" - 5cm 3,00 € Add To Cart Devaniux Pokemon - Zeraora Sticker | 2.5" - 6.5cm 3,50 € Add To Cart Devaniux Pokemon - Lucario Sticker | 2.5" - 6.5cm 3,50 € Add To Cart Devaniux YuGiOh! Stickers - Suwaru Set 3,50 € Add To Cart Devaniux Honkai Star Rail - Blade | 59mm 2,50 € Add To Cart Devaniux Honkai Star Rail - Stelle | 59mm 2,50 € Add To Cart Devaniux Honkai Star Rail - Caelus | 59mm 2,50 € Add To Cart Devaniux Keychain | Genshin Impact - Kazuha 8,00 € Add To Cart Devaniux Chibi Thief King Bakura | A6 Print 5,00 € Add To Cart Devaniux Genshin Impact - Stickers | 10cm 4,50 € Add To Cart Devaniux Honkai Star Rail - SET 1 | 59mm 2,50 € Add To Cart Devaniux POKEMON Holo Buttons Set | Button 59mm 2,00 € Add To Cart Devaniux Genshin Impact - Yae Miko | 38 mm 2,00 € Add To Cart Devaniux Genshin Impact - Venti | 38 mm 2,00 € Add To Cart Devaniux Genshin Impact - Tartaglia | 38 mm 2,00 € Add To Cart Devaniux Genshin Impact - Sucrose | 38 mm 2,00 € Add To Cart Devaniux Genshin Impact - Rosaria | 38 mm 2,00 € Add To Cart Devaniux Genshin Impact - Razor | 38 mm 2,00 € Add To Cart Devaniux Genshin Impact - Raiden Shogun | 38 mm 2,00 € Add To Cart Devaniux Genshin Impact - Nahida | 38 mm 2,00 € Add To Cart Devaniux Genshin Impact - Mika | 38 mm 2,00 € Add To Cart Devaniux Genshin Impact - Lisa | 38 mm 2,00 € Add To Cart Devaniux Genshin Impact - Klee | 38 mm 2,00 € Add To Cart Devaniux YUGIOH: Millennium Items | BUTTON 38 mm/1.5 inch 2,10 € 1,26 € 40% Add To Cart Devaniux POKEMON (GEN 1) - #007-#009 - Squirtle, Wartortle, Blastoise | Button 38 m m 2,00 € Add To Cart Devaniux MYSTERY BAG - YGO theme 7,00 € Add To Cart Devaniux B.LACK - Cover | A4 Print 9,00 € Add To Cart Devaniux Dottore - Shush | A4 Print 9,00 € Add To Cart Devaniux Alhaitham - Scatter | A4 Print 12,00 € Add To Cart Devaniux Chibi Thief King Bakura | A6 Print 5,00 € Add To Cart Devaniux KIRAKIRA - Genshin Impact Keychain: Tighnari 12,00 € Add To Cart Devaniux KIRAKIRA - Genshin Impact Keychain: Childe 12,00 € Add To Cart Devaniux KIRAKIRA - Genshin Impact Keychain: Dottore 12,00 € Add To Cart Devaniux KIRAKIRA - Genshin Impact Keychain: Cyno 12,00 € Add To Cart Devaniux Gengar - Sitting | Sticker 2" - 6cm 3,50 € Add To Cart Devaniux Mimikyu | Sticker 2" - 6cm 3,50 € Add To Cart Devaniux Ho-Oh & Lugia - Keychains 12,00 € Add To Cart Devaniux Eevee - Sitting | Sticker 2" - 6cm 3,50 € Add To Cart Devaniux Genshin Impact - Primogems | Sticker Set 7,00 € Add To Cart Devaniux StickerSheet | Yugioh Classic - Yami Bakura 8,00 € Add To Cart Devaniux StickerSheet | Yugioh Classic - Yami Yugi 8,00 € Add To Cart Devaniux StickerSheet | Yugioh Classic - Kaiba Seto 8,00 € Add To Cart Devaniux Mimikyu - Set 01 | Sticker Emotes 13,00 € Add To Cart Devaniux Genshin Impact | 'Neko Costume' - Neuvillette | 2" - 5cm 3,00 € Add To Cart Devaniux Genshin Impact | 'Neko Costume' - Nahida | 2" - 5cm 3,00 € Add To Cart Devaniux Genshin Impact | 'Neko Costume' - Cyno | 2" - 5cm 3,00 € Add To Cart Devaniux Genshin Impact | 'Neko Costume' - Tartaglia | 2" - 5cm 3,00 € Add To Cart Devaniux Genshin Impact | 'Cherish Series'- Dottore | 2" - 5cm 3,00 € Add To Cart Devaniux Pokemon - Zeraora Sticker | 2.5" - 6.5cm 3,50 € Add To Cart * * © 2024. DevaniuxFree ecommerce store Store Links Payment & ShippingOffersPatreonTikTokKo-FiTermsPrivacySitemap Newsletter Subscribe MODAL DIALOG TITLE Modal Dialog Content Cancel Ok Create a free online store Powered by freewebstore.com Get your free online store today - Be your own boss! freewebstore Got a great business idea? Get a free online store just like this one! What do I get? Fully loaded webstore Unlimited products Domain & SSL checkout 24/7 support And more... Why freewebstore? 15+ years 1 million stores created No card required Easy to create What's the catch? Nope, no catch 0% commission Free forever! Premium upgrades available Get Started i ? Want a free online store like this one? - click here freewebstore