www.dodoskin.com
Open in
urlscan Pro
2620:127:f00f:e::
Public Scan
Submitted URL: https://dodoskin.smsb.co/8BrHDP
Effective URL: https://www.dodoskin.com/?utm_source=flow&utm_medium=SMS&utm_campaign=welcome_flow_1501537&wtbap=NTE5NTA5MTUxNzk%3D
Submission: On April 15 via manual from CO — Scanned from DE
Effective URL: https://www.dodoskin.com/?utm_source=flow&utm_medium=SMS&utm_campaign=welcome_flow_1501537&wtbap=NTE5NTA5MTUxNzk%3D
Submission: On April 15 via manual from CO — Scanned from DE
Form analysis
56 forms found in the DOMPOST /localization
<form action="/localization" method="POST"><input name="_method" type="hidden" value="PUT"><input name="source" type="hidden" value="geolocation_recommendation"><input name="return_to" type="hidden"
value="/?utm_source=flow&utm_medium=SMS&utm_campaign=welcome_flow_1501537&wtbap=NTE5NTA5MTUxNzk%3D"><input name="country_code" type="hidden" value="DE"><input name="locale_code" type="hidden" value="de"><button
class="recommendation-modal__close-button" type="submit"><svg aria-label="Dismiss" viewBox="0 0 20 20" xmlns="http://www.w3.org/2000/svg" style="height: 1em; width: 1em;">
<path d="M11.414 10l6.293-6.293a.999.999 0 1 0-1.414-1.414L10 8.586 3.707 2.293a.999.999 0 1 0-1.414 1.414L8.586 10l-6.293 6.293a.999.999 0 1 0 1.414 1.414L10 11.414l6.293 6.293a.997.997 0 0 0 1.414 0 .999.999 0 0 0 0-1.414L11.414 10z"
fill="#333333"></path>
</svg></button></form>
POST /localization
<form action="/localization" method="POST" class="recommendation-modal__form"><input name="_method" type="hidden" value="PUT"><input name="source" type="hidden" value="geolocation_recommendation"><input name="return_to" type="hidden"
value="/?utm_source=flow&utm_medium=SMS&utm_campaign=welcome_flow_1501537&wtbap=NTE5NTA5MTUxNzk%3D"><input name="country_code" type="hidden" value="DE"><input name="locale_code" type="hidden" value="de"><button
class="recommendation-modal__button" type="submit" style="background-color: rgb(0, 0, 0); color: rgb(255, 255, 255);">Fortfahren</button></form>
POST /cart
<form action="/cart" method="post" novalidate="" data-cart-form="">
<div class="cart__widget__wrapper" data-collapsible-single="">
<div class="cart__widget" data-cart-widget="">
<button class="cart__widget__title" type="button" data-collapsible-trigger="" aria-expanded="false" aria-controls="notes">Add order notes<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-toggle-plus"
viewBox="0 0 192 192">
<path d="M30 96h132M96 30v132" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
</svg><svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-toggle-minus" viewBox="0 0 192 192">
<path d="M30 96h132" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
</svg></button>
<div id="notes" aria-expanded="false" data-collapsible-container="">
<div class="cart__widget__content" data-collapsible-content="">
<label for="note">Special instructions for seller</label>
<textarea id="note" name="note" class="cart__field cart__field--textarea" aria-label="Special instructions for seller"></textarea>
</div>
</div>
</div>
<div class="cart__widget" data-cart-widget="">
<button class="cart__widget__title" type="button" data-collapsible-trigger="" aria-expanded="false" aria-controls="gift-notes">Is this a gift? Add a note.<svg aria-hidden="true" focusable="false" role="presentation"
class="icon icon-toggle-plus" viewBox="0 0 192 192">
<path d="M30 96h132M96 30v132" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
</svg><svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-toggle-minus" viewBox="0 0 192 192">
<path d="M30 96h132" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
</svg></button>
<div id="gift-notes" aria-expanded="false" data-collapsible-container="">
<div class="cart__widget__content" data-collapsible-content=""><label for="gift-note">Add a note for recipient</label>
<textarea id="gift-note" name="attributes[Gift note]" class="cart__field cart__field--textarea" aria-label="Add a note for recipient">
</textarea>
</div>
</div>
</div>
</div>
<div class="cart__foot-inner">
<div data-cart-price-holder="">
<div class="cart__total hidden">
<span>Items</span>
<span data-cart-total="0">Free</span>
</div>
<div class="cart__discounts hidden"></div>
</div>
<div class="cart__buttons-wrapper">
<p class="cart__terms cart__errors__content" data-terms-error-message=""></p>
<div class="cart__buttons" data-cart-checkout-buttons="">
<fieldset class="cart__buttons__fieldset" data-cart-checkout-button="">
<div class="discount_code_box" style="display: none;">
<div class="hulkapps_discount_hide">
<input placeholder="Discount code" class="hulkapps_discount_code" autocomplete="off" aria-required="true" size="30" type="text" name="checkout_discount">
<button type="button" class="hulkapps_discount_button btn btn--primary button">Apply</button>
</div>
</div>
<button type="submit" name="checkout" class="cart__checkout btn">Checkout<span data-hulkapps-cart-total="" class="cart__total__money" data-cart-total-price="">Free</span>
</button>
</fieldset>
</div>
</div>
<p class="cart__text" style="margin-bottom: -5px">Volume discounts will be applied during the final checkout.</p>
<p class="cart__text">Shipping & taxes calculated at checkout</p>
</div>
</form>
GET /search
<form class="search-form" action="/search" method="get" role="search" data-search-form="">
<input name="options[prefix]" type="hidden" value="last" aria-label="options[prefix]">
<div class="search-form__inner" data-search-form-inner="">
<div class="search-form__input-holder">
<label for="searchInput-desktop-compress" class="search-form__label">
<span class="visually-hidden">Search for products on our site</span><svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-search" viewBox="0 0 192 192">
<path d="M87 150c34.794 0 63-28.206 63-63s-28.206-63-63-63-63 28.206-63 63 28.206 63 63 63ZM131.55 131.55 168 168" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
</svg></label>
<input type="search" id="searchInput-desktop-compress" class="search-form__input" name="q" value="" aria-label="Search our store" role="combobox" aria-expanded="false" aria-owns="searchResults-desktop-compress"
aria-controls="searchResults-desktop-compress" aria-haspopup="listbox" aria-autocomplete="list" autocorrect="off" autocomplete="off" autocapitalize="off" spellcheck="false">
<button class="search-form__submit visually-hidden" type="submit" tabindex="-1" aria-label="Search"><svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-search" viewBox="0 0 192 192">
<path d="M87 150c34.794 0 63-28.206 63-63s-28.206-63-63-63-63 28.206-63 63 28.206 63 63 63ZM131.55 131.55 168 168" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
</svg></button>
<button type="button" class="search-popdown__close" title="Close" data-popdown-close=""><svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-close" viewBox="0 0 192 192">
<path d="M150 42 42 150M150 150 42 42" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
</svg></button>
</div>
</div>
<div id="searchResults-desktop-compress" class="search-popdown__results">
<div class="predictive-search" data-predictive-search-results="" data-scroll-lock-scrollable="">
<div class="predictive-search__loading-state">
<div class="predictive-search__loader loader loader--line">
<div class="loader-indeterminate"></div>
</div>
</div>
</div>
<span class="predictive-search-status visually-hidden" role="status" aria-hidden="true" data-predictive-search-status=""></span>
</div>
</form>
GET /search
<form class="search-form" action="/search" method="get" role="search" data-search-form="">
<input name="options[prefix]" type="hidden" value="last" aria-label="options[prefix]">
<div class="search-form__inner" data-search-form-inner="">
<div class="search-form__input-holder">
<label for="searchInput-desktop" class="search-form__label">
<span class="visually-hidden">Search for products on our site</span><svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-search" viewBox="0 0 192 192">
<path d="M87 150c34.794 0 63-28.206 63-63s-28.206-63-63-63-63 28.206-63 63 28.206 63 63 63ZM131.55 131.55 168 168" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
</svg></label>
<input type="search" id="searchInput-desktop" class="search-form__input" name="q" value="" aria-label="Search our store" role="combobox" aria-expanded="false" aria-owns="searchResults-desktop" aria-controls="searchResults-desktop"
aria-haspopup="listbox" aria-autocomplete="list" autocorrect="off" autocomplete="off" autocapitalize="off" spellcheck="false">
<button class="search-form__submit visually-hidden" type="submit" tabindex="-1" aria-label="Search"><svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-search" viewBox="0 0 192 192">
<path d="M87 150c34.794 0 63-28.206 63-63s-28.206-63-63-63-63 28.206-63 63 28.206 63 63 63ZM131.55 131.55 168 168" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
</svg></button>
<button type="button" class="search-popdown__close" title="Close" data-popdown-close=""><svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-close" viewBox="0 0 192 192">
<path d="M150 42 42 150M150 150 42 42" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
</svg></button>
</div>
</div>
<div id="searchResults-desktop" class="search-popdown__results">
<div class="predictive-search" data-predictive-search-results="" data-scroll-lock-scrollable="">
<div class="predictive-search__loading-state">
<div class="predictive-search__loader loader loader--line">
<div class="loader-indeterminate"></div>
</div>
</div>
</div>
<span class="predictive-search-status visually-hidden" role="status" aria-hidden="true" data-predictive-search-status=""></span>
</div>
</form>
GET /search
<form class="search-form" action="/search" method="get" role="search" data-search-form="">
<input name="options[prefix]" type="hidden" value="last" aria-label="options[prefix]">
<div class="search-form__inner" data-search-form-inner="">
<div class="search-form__input-holder">
<label for="searchInput-mobile" class="search-form__label">
<span class="visually-hidden">Search for products on our site</span><svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-search" viewBox="0 0 192 192">
<path d="M87 150c34.794 0 63-28.206 63-63s-28.206-63-63-63-63 28.206-63 63 28.206 63 63 63ZM131.55 131.55 168 168" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
</svg></label>
<input type="search" id="searchInput-mobile" class="search-form__input" name="q" value="" aria-label="Search our store" role="combobox" aria-expanded="false" aria-owns="searchResults-mobile" aria-controls="searchResults-mobile"
aria-haspopup="listbox" aria-autocomplete="list" autocorrect="off" autocomplete="off" autocapitalize="off" spellcheck="false">
<button class="search-form__submit visually-hidden" type="submit" tabindex="-1" aria-label="Search"><svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-search" viewBox="0 0 192 192">
<path d="M87 150c34.794 0 63-28.206 63-63s-28.206-63-63-63-63 28.206-63 63 28.206 63 63 63ZM131.55 131.55 168 168" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
</svg></button>
<button type="button" class="search-popdown__close" title="Close" data-popdown-close=""><svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-close" viewBox="0 0 192 192">
<path d="M150 42 42 150M150 150 42 42" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
</svg></button>
</div>
</div>
<div id="searchResults-mobile" class="search-popdown__results">
<div class="predictive-search" data-predictive-search-results="" data-scroll-lock-scrollable="">
<div class="predictive-search__loading-state">
<div class="predictive-search__loader loader loader--line">
<div class="loader-indeterminate"></div>
</div>
</div>
</div>
<span class="predictive-search-status visually-hidden" role="status" aria-hidden="true" data-predictive-search-status=""></span>
</div>
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414-7955095978140" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43405229981852" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="0">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7955095978140" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414-7933082435740" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43330562752668" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7933082435740" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414-7916902514844" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43282830196892" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7916902514844" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414-7916818170012" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43282471583900" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7916818170012" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414-7955041190044" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43404876415132" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="0">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7955041190044" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414-7952389963932" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43393238663324" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="0">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7952389963932" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414-7945034793116" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43370671734940" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="0">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7945034793116" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414-7943150960796" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43366239207580" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="0">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7943150960796" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414-7941485035676" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43355223949468" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7941485035676" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414-7941434310812" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43354980253852" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7941434310812" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414-7888351756444" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43169294712988" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="0">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7888351756444" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414-7825155358876" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="42951860256924" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="0">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7825155358876" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414-7825142186140" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="42951800160412" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="0">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7825142186140" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414-7825139007644" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="42951791313052" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7825139007644" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414-7825110401180" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="42951750910108" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7825110401180" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414-7824622518428" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="42950274056348" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7824622518428" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414-7824588800156" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="42950205210780" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7824588800156" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414-7824584900764" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="42950191906972" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7824584900764" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f-7955041190044" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43404876415132" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="0">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7955041190044" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f-7952389963932" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43393238663324" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="0">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7952389963932" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f-7945034793116" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43370671734940" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="0">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7945034793116" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f-7943054786716" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43365781897372" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="0">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7943054786716" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f-7941505515676" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43355319369884" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7941505515676" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f-7941499158684" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43355290697884" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7941499158684" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f-7941486608540" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43355229749404" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7941486608540" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f-7941485035676" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43355223949468" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7941485035676" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f-7941467996316" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43355141144732" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7941467996316" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f-7941440962716" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43355011973276" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7941440962716" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f-7941434310812" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43354980253852" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7941434310812" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f-7941432705180" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43354975600796" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7941432705180" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f-7941424808092" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43354925301916" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7941424808092" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f-7941339971740" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43354440269980" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7941339971740" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f-7941337186460" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43354423656604" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7941337186460" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f-7939593928860" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43342888632476" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7939593928860" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f-7937650393244" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43340700516508" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7937650393244" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f-7934849581212" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43332760338588" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7934849581212" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f-7934847221916" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43332722262172" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7934847221916" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f-7934846992540" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43332720525468" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7934846992540" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f-7934846959772" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43332718985372" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7934846959772" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f-7934784438428" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43332642701468" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7934784438428" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f-7934516363420" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43332492722332" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7934516363420" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f-7933082435740" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43330562752668" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7933082435740" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4cf35844-daa9-481f-b090-8c1bf37ee05d-7448181571740" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="42041198543004" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="0">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7448181571740" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4cf35844-daa9-481f-b090-8c1bf37ee05d" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4cf35844-daa9-481f-b090-8c1bf37ee05d-6044550037660" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="40298574741660" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="0">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="6044550037660" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4cf35844-daa9-481f-b090-8c1bf37ee05d" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4cf35844-daa9-481f-b090-8c1bf37ee05d-7547838824604" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="42317188694172" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7547838824604" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4cf35844-daa9-481f-b090-8c1bf37ee05d" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4cf35844-daa9-481f-b090-8c1bf37ee05d-6044838428828" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="40291862184092" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="6044838428828" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4cf35844-daa9-481f-b090-8c1bf37ee05d" aria-label="section-id">
</form>
POST /contact#NewsletterForm--template--16191090884764__f91dba82-a9f9-4019-9002-a16133ec5c98
<form method="post" action="/contact#NewsletterForm--template--16191090884764__f91dba82-a9f9-4019-9002-a16133ec5c98" id="NewsletterForm--template--16191090884764__f91dba82-a9f9-4019-9002-a16133ec5c98" accept-charset="UTF-8" class="newsletter-form"
data-newsletter-form=""><input type="hidden" name="form_type" value="customer" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="contact[accepts_marketing]" value="true"
aria-label="contact[accepts_marketing]">
<div class="input-group">
<div class="input-group__fields input-group__fields--name">
<div class="input-group__item input-group__item--name">
<input type="text" id="Name--template--16191090884764__f91dba82-a9f9-4019-9002-a16133ec5c98" class="input-group__field input-group__field--name" value="" placeholder="Your name" name="contact[first_name]" autocorrect="off"
autocapitalize="off" aria-label="Your name">
</div>
<div class="input-group__item input-group__item--email">
<input type="email" id="Email--template--16191090884764__f91dba82-a9f9-4019-9002-a16133ec5c98" class="input-group__field input-group__field--email" value="" placeholder="Your email" name="contact[email]" autocorrect="off" autocapitalize="off"
aria-label="Your email">
</div>
</div>
<div class="input-group__item input-group__item--btn input-group__item--btn-width">
<button type="submit" name="subscribe" id="SubscribeSubmit--template--16191090884764__f91dba82-a9f9-4019-9002-a16133ec5c98" class="input-group__btn btn">Sign up</button>
</div>
</div>
<div class="errors">Email is invalid or already taken.</div>
</form>
POST /contact#NewsletterForm--footer-block-3
<form method="post" action="/contact#NewsletterForm--footer-block-3" id="NewsletterForm--footer-block-3" accept-charset="UTF-8" class="newsletter-form" data-newsletter-form=""><input type="hidden" name="form_type" value="customer"
aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="contact[accepts_marketing]" value="true" aria-label="contact[accepts_marketing]">
<div class="input-group input-group--inline">
<div class="input-group__fields">
<div class="input-group__item input-group__item--email">
<input type="email" id="Email--footer-block-3" class="input-group__field input-group__field--email" value="" placeholder="Your email" name="contact[email]" autocorrect="off" autocapitalize="off" aria-label="Your email">
</div>
</div>
<div class="input-group__item input-group__item--btn">
<button type="submit" name="subscribe" id="SubscribeSubmit--footer-block-3" class="input-group__btn input-group__btn--icon"><span class="visually-hidden">Subscribe to Our Newsletter</span><svg aria-hidden="true" focusable="false"
role="presentation" class="icon icon-select" viewBox="0 0 192 192">
<path d="m72 36 60 60-60 60" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
</svg></button>
</div>
</div>
<div class="errors">Email is invalid or already taken.</div>
</form>
POST /localization
<form method="post" action="/localization" id="LocalizationForm" accept-charset="UTF-8" class="footer__select-popout" enctype="multipart/form-data"><input type="hidden" name="form_type" value="localization" aria-label="form_type"><input type="hidden"
name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="_method" value="put" aria-label="_method"><input type="hidden" name="return_to"
value="/?utm_source=flow&utm_medium=SMS&utm_campaign=welcome_flow_1501537&wtbap=NTE5NTA5MTUxNzk%3D" aria-label="return_to">
<div>
<h2 class="visually-hidden" id="lang-heading"> Language </h2>
<div class="select-popout" data-popout="">
<button type="button" class="select-popout__toggle" aria-expanded="false" aria-controls="lang-list" aria-describedby="lang-heading" data-popout-toggle=""> English <svg aria-hidden="true" focusable="false" role="presentation"
class="icon icon-select" viewBox="0 0 192 192">
<path d="m72 36 60 60-60 60" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
</svg></button>
<div id="lang-list" class="select-popout__list" data-popout-list="">
<ul class="select-popout__list__scroll">
<li class="select-popout__item select-popout__item--current">
<a class="select-popout__option" href="#" lang="" data-value="en" data-popout-option="">
<span>English</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" lang="" data-value="fr" data-popout-option="">
<span>français</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" lang="" data-value="ja" data-popout-option="">
<span>日本語</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" lang="" data-value="es" data-popout-option="">
<span>Español</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" lang="" data-value="ar" data-popout-option="">
<span>العربية</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" lang="" data-value="de" data-popout-option="">
<span>Deutsch</span>
</a>
</li>
</ul>
</div>
<input type="hidden" name="locale_code" id="LocaleSelector" value="en" data-popout-input="" aria-label="locale_code">
</div>
</div>
<div>
<h2 class="visually-hidden" id="currency-heading"> Currency </h2>
<div class="select-popout" data-popout=""><button type="button" class="select-popout__toggle" aria-expanded="false" aria-controls="currency-list" aria-describedby="currency-heading" data-popout-toggle=""> USD $<svg aria-hidden="true"
focusable="false" role="presentation" class="icon icon-select" viewBox="0 0 192 192">
<path d="m72 36 60 60-60 60" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
</svg></button>
<div id="currency-list" class="select-popout__list" data-popout-list="">
<ul class="select-popout__list__scroll">
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="AED" data-popout-option="">
<span>AED د.إ</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="AFN" data-popout-option="">
<span>AFN ؋</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="ALL" data-popout-option="">
<span>ALL L</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="AMD" data-popout-option="">
<span>AMD դր.</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="ANG" data-popout-option="">
<span>ANG ƒ</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="ARS" data-popout-option="">
<span>ARS $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="AUD" data-popout-option="">
<span>AUD $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="AWG" data-popout-option="">
<span>AWG ƒ</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="AZN" data-popout-option="">
<span>AZN ₼</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="BAM" data-popout-option="">
<span>BAM КМ</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="BBD" data-popout-option="">
<span>BBD $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="BDT" data-popout-option="">
<span>BDT ৳</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="BGN" data-popout-option="">
<span>BGN лв.</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="BIF" data-popout-option="">
<span>BIF Fr</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="BND" data-popout-option="">
<span>BND $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="BOB" data-popout-option="">
<span>BOB Bs.</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="BRL" data-popout-option="">
<span>BRL R$</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="BSD" data-popout-option="">
<span>BSD $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="BWP" data-popout-option="">
<span>BWP P</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="BZD" data-popout-option="">
<span>BZD $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="CAD" data-popout-option="">
<span>CAD $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="CDF" data-popout-option="">
<span>CDF Fr</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="CHF" data-popout-option="">
<span>CHF CHF</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="CNY" data-popout-option="">
<span>CNY ¥</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="CRC" data-popout-option="">
<span>CRC ₡</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="CVE" data-popout-option="">
<span>CVE $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="CZK" data-popout-option="">
<span>CZK Kč</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="DJF" data-popout-option="">
<span>DJF Fdj</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="DKK" data-popout-option="">
<span>DKK kr.</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="DOP" data-popout-option="">
<span>DOP $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="DZD" data-popout-option="">
<span>DZD د.ج</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="EGP" data-popout-option="">
<span>EGP ج.م</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="ETB" data-popout-option="">
<span>ETB Br</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="EUR" data-popout-option="">
<span>EUR €</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="FJD" data-popout-option="">
<span>FJD $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="FKP" data-popout-option="">
<span>FKP £</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="GBP" data-popout-option="">
<span>GBP £</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="GMD" data-popout-option="">
<span>GMD D</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="GNF" data-popout-option="">
<span>GNF Fr</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="GTQ" data-popout-option="">
<span>GTQ Q</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="GYD" data-popout-option="">
<span>GYD $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="HKD" data-popout-option="">
<span>HKD $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="HNL" data-popout-option="">
<span>HNL L</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="HUF" data-popout-option="">
<span>HUF Ft</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="IDR" data-popout-option="">
<span>IDR Rp</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="ILS" data-popout-option="">
<span>ILS ₪</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="INR" data-popout-option="">
<span>INR ₹</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="ISK" data-popout-option="">
<span>ISK kr</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="JMD" data-popout-option="">
<span>JMD $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="JPY" data-popout-option="">
<span>JPY ¥</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="KES" data-popout-option="">
<span>KES KSh</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="KGS" data-popout-option="">
<span>KGS som</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="KHR" data-popout-option="">
<span>KHR ៛</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="KMF" data-popout-option="">
<span>KMF Fr</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="KYD" data-popout-option="">
<span>KYD $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="KZT" data-popout-option="">
<span>KZT 〒</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="LAK" data-popout-option="">
<span>LAK ₭</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="LBP" data-popout-option="">
<span>LBP ل.ل</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="LKR" data-popout-option="">
<span>LKR ₨</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="MAD" data-popout-option="">
<span>MAD د.م.</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="MDL" data-popout-option="">
<span>MDL L</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="MKD" data-popout-option="">
<span>MKD ден</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="MNT" data-popout-option="">
<span>MNT ₮</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="MOP" data-popout-option="">
<span>MOP P</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="MUR" data-popout-option="">
<span>MUR ₨</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="MVR" data-popout-option="">
<span>MVR MVR</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="MWK" data-popout-option="">
<span>MWK MK</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="MXN" data-popout-option="">
<span>MXN $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="MYR" data-popout-option="">
<span>MYR RM</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="NGN" data-popout-option="">
<span>NGN ₦</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="NIO" data-popout-option="">
<span>NIO C$</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="NPR" data-popout-option="">
<span>NPR ₨</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="NZD" data-popout-option="">
<span>NZD $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="PEN" data-popout-option="">
<span>PEN S/.</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="PGK" data-popout-option="">
<span>PGK K</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="PHP" data-popout-option="">
<span>PHP ₱</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="PKR" data-popout-option="">
<span>PKR ₨</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="PLN" data-popout-option="">
<span>PLN zł</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="PYG" data-popout-option="">
<span>PYG ₲</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="QAR" data-popout-option="">
<span>QAR ر.ق</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="RON" data-popout-option="">
<span>RON Lei</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="RSD" data-popout-option="">
<span>RSD РСД</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="RWF" data-popout-option="">
<span>RWF FRw</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="SAR" data-popout-option="">
<span>SAR ر.س</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="SBD" data-popout-option="">
<span>SBD $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="SEK" data-popout-option="">
<span>SEK kr</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="SGD" data-popout-option="">
<span>SGD $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="SHP" data-popout-option="">
<span>SHP £</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="SLL" data-popout-option="">
<span>SLL Le</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="STD" data-popout-option="">
<span>STD Db</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="THB" data-popout-option="">
<span>THB ฿</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="TJS" data-popout-option="">
<span>TJS ЅМ</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="TOP" data-popout-option="">
<span>TOP T$</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="TTD" data-popout-option="">
<span>TTD $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="TWD" data-popout-option="">
<span>TWD $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="TZS" data-popout-option="">
<span>TZS Sh</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="UAH" data-popout-option="">
<span>UAH ₴</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="UGX" data-popout-option="">
<span>UGX USh</span>
</a>
</li>
<li class="select-popout__item select-popout__item--current">
<a class="select-popout__option" href="#" aria-current="true" data-value="USD" data-popout-option="">
<span>USD $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="UYU" data-popout-option="">
<span>UYU $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="UZS" data-popout-option="">
<span>UZS </span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="VND" data-popout-option="">
<span>VND ₫</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="VUV" data-popout-option="">
<span>VUV Vt</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="WST" data-popout-option="">
<span>WST T</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="XAF" data-popout-option="">
<span>XAF Fr</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="XCD" data-popout-option="">
<span>XCD $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="XOF" data-popout-option="">
<span>XOF Fr</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="XPF" data-popout-option="">
<span>XPF Fr</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="YER" data-popout-option="">
<span>YER ﷼</span>
</a>
</li>
</ul>
</div>
<input type="hidden" name="currency_code" id="CurrencySelector" value="USD" data-popout-input="" aria-label="currency_code">
</div>
</div>
</form>
POST /cart/update
<form method="post" action="/cart/update" id="currency_form" accept-charset="UTF-8" class="currency-selector small--hide" enctype="multipart/form-data"><input type="hidden" name="form_type" value="currency" aria-label="form_type"><input type="hidden"
name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="return_to" value="/" aria-label="return_to"><input type="hidden" name="currency" value="CurrencyDrop" aria-label="currency"></form>
Text Content
DEIN STANDORT IST AUF DEUTSCHLAND FESTGELEGT * In EUR € einkaufen * Versandoptionen für Deutschland anzeigen * Die Sprache ist auf Deutsch festgelegt Fortfahren Land/Region und Sprache ändern This website uses cookies to make sure you get the best experience with us. Learn more Got it! Decline Back Accessibility options Are you sure you want to hide the widget forever? If you need it back, please clear your cookies. OkCancel Content Bigger Cursor Bigger Cursor Text Reader Tooltips Line Height Line Height Hide Images Hide images Readable Fonts Readable fonts Dyslexic Font Dyslexic Font Stop Animations Stop Animations Colors Invert Color Invert Colors Brightness Brightness Contrast Contrast Grayscale Color Grayscale Saturation Saturation Navigation Reading Line Reading Line Highlight Links Highlight Links Text Reader Read page Reading Mask Reading Mask Page Structure Page Structure LanguageEnglish (USA) Search language English (USA)SwedishFinnishGermanSpanishPortugueseTurkishFrenchJapaneseKoreanHebrewLatvianPolishGreekThai Accessibly App Accessibility Statement Accessibly App is committed to making sites accessible for all, including people with disabilities. We are continuously improving the service we provide through our app to comply with increased accessibility standards, guidelines, and to make the browsing experience better for everyone. Conformance status The app uses the Web Content Accessibility Guidelines (WCAG) defined requirements to improve accessibility for people with disabilities. It defines three levels of conformance: Level A, Level AA, and Level AAA. Accessibly App is following the best guidelines and is partially conformant with WCAG 2.1 level AA. Technical information Accessibly App is an app supported in Shopify and Wordpress environments. The app relies on the following technologies: HTML CSS JavaScript NodeJs MongoDB Accessibly App features When a site has Accessibly App i ac-h4 installed, the website can be adjusted with keyboard navigation using the “tab” key (WCAG 2.1/2.1.1). Additionally, see the list of all provided Accessibly App features and tools for better website experience: Zoom | WCAG 2.1 / 1.4.4 This feature enables users to enhance the size of the text to up to three times the original text for better text readability. Bigger cursor Makes the cursor bigger and more prominent. Increases the size for better site browsing. Invert colors Invert the colors of the website content. For those with decreased vision, the high contrast greatly helps to read the site better. Tweak Contrast | WCAG 2.1 / 1.4.6 This feature lets users manually select from two options: to enhance the contrast of the website or to decrease the contrast. Tweak Brightness | WCAG 2.1 / 1.4.6 This feature lets users update the brightness on the site. The content can either be made brighter or darker. Grayscale | WCAG 2.1 / 1.4.6 Users can turn on grayscale, making the website content appear only in shades of gray. This benefits people with visual impairment. Reading Line Add a supportive reading line to the site. Readable fonts Convert the fonts available on-site to one of the most easily readable fonts: Helvetica. Alt Text and Images Ability to read alt text of images. As of now, our tool has added a feature where alt descriptions for images without them are generated using Google's Vision AI. In the event that you haven't manually written these image descriptions yourself, this greatly helps people with visual impairment browse your site. Tooltips | WCAG 2.1 / 2.5.3 Add labels to images that contain a written description of the image. Highlight links Highlight links to make them more prominent. Hide images Hide images on the site. This provides better site readability for people with visual impairment. Read page A feature that allows a voice to read the text on your site out loud to visitors. Notes & Feedback We always try to update our services and operate in the best possible manner to benefit all of our clients and their site visitors. We cannot control or correct problems with third-party sites, but please let us know if you encounter difficulty with any sites we link to so we can pass the information along to the site owners. You may also want to address your concerns directly to these third parties. Reset settings Accessibility statement × Reset Cancel Continue Skip to content This site has limited support for your browser. We recommend switching to Edge, Chrome, Safari, or Firefox. AMAZON PAY now available! Upgrading Our Delivery System: Apologies for High-Demand Delays. 🙏🙏 FREE SHIPPING on orders over $40 AMAZON PAY now available! Upgrading Our Delivery System: Apologies for High-Demand Delays. 🙏🙏 FREE SHIPPING on orders over $40 AMAZON PAY now available! Upgrading Our Delivery System: Apologies for High-Demand Delays. 🙏🙏 FREE SHIPPING on orders over $40 AMAZON PAY now available! Upgrading Our Delivery System: Apologies for High-Demand Delays. 🙏🙏 FREE SHIPPING on orders over $40 AMAZON PAY now available! Upgrading Our Delivery System: Apologies for High-Demand Delays. 🙏🙏 FREE SHIPPING on orders over $40 AMAZON PAY now available! Upgrading Our Delivery System: Apologies for High-Demand Delays. 🙏🙏 FREE SHIPPING on orders over $40 AMAZON PAY now available! Upgrading Our Delivery System: Apologies for High-Demand Delays. 🙏🙏 FREE SHIPPING on orders over $40 AMAZON PAY now available! Upgrading Our Delivery System: Apologies for High-Demand Delays. 🙏🙏 FREE SHIPPING on orders over $40 AMAZON PAY now available! Upgrading Our Delivery System: Apologies for High-Demand Delays. 🙏🙏 FREE SHIPPING on orders over $40 AMAZON PAY now available! Upgrading Our Delivery System: Apologies for High-Demand Delays. 🙏🙏 FREE SHIPPING on orders over $40 AMAZON PAY now available! Upgrading Our Delivery System: Apologies for High-Demand Delays. 🙏🙏 FREE SHIPPING on orders over $40 AMAZON PAY now available! Upgrading Our Delivery System: Apologies for High-Demand Delays. 🙏🙏 FREE SHIPPING on orders over $40 AMAZON PAY now available! Upgrading Our Delivery System: Apologies for High-Demand Delays. 🙏🙏 FREE SHIPPING on orders over $40 Close * USDARSEURGBPJPYMXNMYRCADAUDINRAEDBNDCHFEGPHKDIDRIQDJEPMADMWKMVRMURNTDNZDPHPRUBSARSGDSTDSZLSYPTHBTRYTNDTOPTWDVNDYERZMKZARAFNALLAMDANGAOAAWGAZNBAMBBDBDTBGNBHDBIFBMDBOBBRLBSDBTNBWPBYNBYRBZDCDFCLPCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDERNETBFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHNLHRKHTGHUFILSIMPIRRISKJMDJODKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMDLMGAMKDMMKMNTMOPMROMZNNADNGNNIONOKNPROMRPABPENPGKPKRPLNPYGQARRONRSDRWFSBDSCRSDGSEKSHPSLLSOSSPLSRDSVCTJSTMMTMTTTDTVDTZSUAHUGXUYUUZSVEFVUVWSTXAFXAGXAUXBTXCDXDRXOFXPDXPFXPTZMWZWD USD * USD * ARS * EUR * GBP * JPY * MXN * MYR * CAD * AUD * INR * AED * BND * CHF * EGP * HKD * IDR * IQD * JEP * MAD * MWK * MVR * MUR * NTD * NZD * PHP * RUB * SAR * SGD * STD * SZL * SYP * THB * TRY * TND * TOP * TWD * VND * YER * ZMK * ZAR * AFN * ALL * AMD * ANG * AOA * AWG * AZN * BAM * BBD * BDT * BGN * BHD * BIF * BMD * BOB * BRL * BSD * BTN * BWP * BYN * BYR * BZD * CDF * CLP * CNY * COP * CRC * CUC * CUP * CVE * CZK * DJF * DKK * DOP * DZD * ERN * ETB * FJD * FKP * GEL * GGP * GHS * GIP * GMD * GNF * GTQ * GYD * HNL * HRK * HTG * HUF * ILS * IMP * IRR * ISK * JMD * JOD * KES * KGS * KHR * KMF * KPW * KRW * KWD * KYD * KZT * LAK * LBP * LKR * LRD * LSL * LYD * MDL * MGA * MKD * MMK * MNT * MOP * MRO * MZN * NAD * NGN * NIO * NOK * NPR * OMR * PAB * PEN * PGK * PKR * PLN * PYG * QAR * RON * RSD * RWF * SBD * SCR * SDG * SEK * SHP * SLL * SOS * SPL * SRD * SVC * TJS * TMM * TMT * TTD * TVD * TZS * UAH * UGX * UYU * UZS * VEF * VUV * WST * XAF * XAG * XAU * XBT * XCD * XDR * XOF * XPD * XPF * XPT * ZMW * ZWD * Brands See More * VIEW ALL Brands A-Z See More * The SAEM * A'PIEU * COSRX * ETUDE HOUSE * Sulwhasoo * TONYMOLY * HERA * LANEIGE * MISSHA * Krave * Innisfree * OHUI * Benton * More + * Only At DODO See More * TAMBURINS * Bellboy Studio * HA'SOL * D’ALBA * Atomy * Dermamular * Daleaf * 3CE * MUZIGAE MANSION * Trendy Brands See More * MUZIGAE MANSION * D’ALBA * A'PIEU * AESTURA * ANUA * AMUSE * Beauty of Joseon * ROM&ND * hince * MEDI-PEEL * COSRX * SKIN1004 * ROUND LAB * MEDIHEAL * Dr.G * Torriden * Abib * 💝 Today's Deals See More * 24HR : TIME DEAL * BOGO 1+1 FREE * K-BEAUTY UNDER $10 * DODOBOX * 2024 SPRING SEASON * NEAR EXPIRY BIG SALE * ROCKET-SPEED SHIPPING🚀 * US Stock See More * SKINCARE (US Stock) See More * Moisturizers * Suncare * Men * Baby * Special care * CLEANSER (US Stock) See More * Exfoliators * Cleansing Foam * Cleansing Water/Lotion/Tissue * Cleansing Oil/Balm * Cleansing Cream/Gel * Facial Soap & ETC * Makeup Remover * MAKEUP (US Stock) See More * Face * Eye * Lip * Cheek * HAIR & BODY (US Stock) See More * Hair * Hand/Foot * Tooth Care * TOOLS (US Stock) See More * Makeup Tools & Brushes * Eyelashes * Beauty Device & Tools * More * Best * New In * Makeup See More * Face See More * Base/Primer * Cushion Pact/Puff * Foundation/BB/CC * Concealer * Powder/Fixer * Eye See More * Eyebrow * Eyeshadow * Eyeliner * Mascara * Lip See More * Lipstick/Rouge * Lip Tint * Balm/Gloss * Cheek See More * Blush * Highlighter * Contour * Skincare See More * Cleansers See More * Exfoliators * Cleansing Foam * Cleansing Water/Lotion/Tissue * Cleansing Oil/Balm * Cleansing Cream/Gel * Facial Soap & ETC * Makeup Remover * Moisturizers See More * Skin/Toner/Mist * Lotion/Emulsion * Serum * Essence/Ampoule * Cream/Balm/Gel * Facial Oil * Eye & Neck Care * Lip Care * Pack/Mask * Set * Men * Baby * Special Care * SPF Sun * Hair/Body See More * Hair Care See More * Shampoo * Conditioner * Hair Tonic * Treatments/Packs * Serum/Essence/Oil/Mist * Styling * Body See More * Body Care * Body Wash/Exfoliators * Hand/Foot * Tooth Care * Perfume/Fragrance * Tools See More * Makeup Tools & Brushes * Beauty Device & Tools * More * Wellness * USDARSEURGBPJPYMXNMYRCADAUDINRAEDBNDCHFEGPHKDIDRIQDJEPMADMWKMVRMURNTDNZDPHPRUBSARSGDSTDSZLSYPTHBTRYTNDTOPTWDVNDYERZMKZARAFNALLAMDANGAOAAWGAZNBAMBBDBDTBGNBHDBIFBMDBOBBRLBSDBTNBWPBYNBYRBZDCDFCLPCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDERNETBFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHNLHRKHTGHUFILSIMPIRRISKJMDJODKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMDLMGAMKDMMKMNTMOPMROMZNNADNGNNIONOKNPROMRPABPENPGKPKRPLNPYGQARRONRSDRWFSBDSCRSDGSEKSHPSLLSOSSPLSRDSVCTJSTMMTMTTTDTVDTZSUAHUGXUYUUZSVEFVUVWSTXAFXAGXAUXBTXCDXDRXOFXPDXPFXPTZMWZWD * Brands See More * VIEW ALL Brands A-Z See More * The SAEM * A'PIEU * COSRX * ETUDE HOUSE * Sulwhasoo * TONYMOLY * HERA * LANEIGE * MISSHA * Krave * Innisfree * OHUI * Benton * More + * Only At DODO See More * TAMBURINS * Bellboy Studio * HA'SOL * D’ALBA * Atomy * Dermamular * Daleaf * 3CE * MUZIGAE MANSION * Trendy Brands See More * MUZIGAE MANSION * D’ALBA * A'PIEU * AESTURA * ANUA * AMUSE * Beauty of Joseon * ROM&ND * hince * MEDI-PEEL * COSRX * SKIN1004 * ROUND LAB * MEDIHEAL * Dr.G * Torriden * Abib * 💝 Today's Deals See More * 24HR : TIME DEAL * BOGO 1+1 FREE * K-BEAUTY UNDER $10 * DODOBOX * 2024 SPRING SEASON * NEAR EXPIRY BIG SALE * ROCKET-SPEED SHIPPING🚀 * US Stock See More * SKINCARE (US Stock) See More * Moisturizers * Suncare * Men * Baby * Special care * CLEANSER (US Stock) See More * Exfoliators * Cleansing Foam * Cleansing Water/Lotion/Tissue * Cleansing Oil/Balm * Cleansing Cream/Gel * Facial Soap & ETC * Makeup Remover * MAKEUP (US Stock) See More * Face * Eye * Lip * Cheek * HAIR & BODY (US Stock) See More * Hair * Hand/Foot * Tooth Care * TOOLS (US Stock) See More * Makeup Tools & Brushes * Eyelashes * Beauty Device & Tools * More * Best * New In * Makeup See More * Face See More * Base/Primer * Cushion Pact/Puff * Foundation/BB/CC * Concealer * Powder/Fixer * Eye See More * Eyebrow * Eyeshadow * Eyeliner * Mascara * Lip See More * Lipstick/Rouge * Lip Tint * Balm/Gloss * Cheek See More * Blush * Highlighter * Contour * Skincare See More * Cleansers See More * Exfoliators * Cleansing Foam * Cleansing Water/Lotion/Tissue * Cleansing Oil/Balm * Cleansing Cream/Gel * Facial Soap & ETC * Makeup Remover * Moisturizers See More * Skin/Toner/Mist * Lotion/Emulsion * Serum * Essence/Ampoule * Cream/Balm/Gel * Facial Oil * Eye & Neck Care * Lip Care * Pack/Mask * Set * Men * Baby * Special Care * SPF Sun * Hair/Body See More * Hair Care See More * Shampoo * Conditioner * Hair Tonic * Treatments/Packs * Serum/Essence/Oil/Mist * Styling * Body See More * Body Care * Body Wash/Exfoliators * Hand/Foot * Tooth Care * Perfume/Fragrance * Tools See More * Makeup Tools & Brushes * Beauty Device & Tools * More * Wellness * USDARSEURGBPJPYMXNMYRCADAUDINRAEDBNDCHFEGPHKDIDRIQDJEPMADMWKMVRMURNTDNZDPHPRUBSARSGDSTDSZLSYPTHBTRYTNDTOPTWDVNDYERZMKZARAFNALLAMDANGAOAAWGAZNBAMBBDBDTBGNBHDBIFBMDBOBBRLBSDBTNBWPBYNBYRBZDCDFCLPCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDERNETBFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHNLHRKHTGHUFILSIMPIRRISKJMDJODKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMDLMGAMKDMMKMNTMOPMROMZNNADNGNNIONOKNPROMRPABPENPGKPKRPLNPYGQARRONRSDRWFSBDSCRSDGSEKSHPSLLSOSSPLSRDSVCTJSTMMTMTTTDTVDTZSUAHUGXUYUUZSVEFVUVWSTXAFXAGXAUXBTXCDXDRXOFXPDXPFXPTZMWZWD * Brands See More * VIEW ALL Brands A-Z See More * The SAEM * A'PIEU * COSRX * ETUDE HOUSE * Sulwhasoo * TONYMOLY * HERA * LANEIGE * MISSHA * Krave * Innisfree * OHUI * Benton * More + * Only At DODO See More * TAMBURINS * Bellboy Studio * HA'SOL * D’ALBA * Atomy * Dermamular * Daleaf * 3CE * MUZIGAE MANSION * Trendy Brands See More * MUZIGAE MANSION * D’ALBA * A'PIEU * AESTURA * ANUA * AMUSE * Beauty of Joseon * ROM&ND * hince * MEDI-PEEL * COSRX * SKIN1004 * ROUND LAB * MEDIHEAL * Dr.G * Torriden * Abib * 💝 Today's Deals See More * 24HR : TIME DEAL * BOGO 1+1 FREE * K-BEAUTY UNDER $10 * DODOBOX * 2024 SPRING SEASON * NEAR EXPIRY BIG SALE * ROCKET-SPEED SHIPPING🚀 * US Stock See More * SKINCARE (US Stock) See More * Moisturizers * Suncare * Men * Baby * Special care * CLEANSER (US Stock) See More * Exfoliators * Cleansing Foam * Cleansing Water/Lotion/Tissue * Cleansing Oil/Balm * Cleansing Cream/Gel * Facial Soap & ETC * Makeup Remover * MAKEUP (US Stock) See More * Face * Eye * Lip * Cheek * HAIR & BODY (US Stock) See More * Hair * Hand/Foot * Tooth Care * TOOLS (US Stock) See More * Makeup Tools & Brushes * Eyelashes * Beauty Device & Tools * More * Best * New In * Makeup See More * Face See More * Base/Primer * Cushion Pact/Puff * Foundation/BB/CC * Concealer * Powder/Fixer * Eye See More * Eyebrow * Eyeshadow * Eyeliner * Mascara * Lip See More * Lipstick/Rouge * Lip Tint * Balm/Gloss * Cheek See More * Blush * Highlighter * Contour * Skincare See More * Cleansers See More * Exfoliators * Cleansing Foam * Cleansing Water/Lotion/Tissue * Cleansing Oil/Balm * Cleansing Cream/Gel * Facial Soap & ETC * Makeup Remover * Moisturizers See More * Skin/Toner/Mist * Lotion/Emulsion * Serum * Essence/Ampoule * Cream/Balm/Gel * Facial Oil * Eye & Neck Care * Lip Care * Pack/Mask * Set * Men * Baby * Special Care * SPF Sun * Hair/Body See More * Hair Care See More * Shampoo * Conditioner * Hair Tonic * Treatments/Packs * Serum/Essence/Oil/Mist * Styling * Body See More * Body Care * Body Wash/Exfoliators * Hand/Foot * Tooth Care * Perfume/Fragrance * Tools See More * Makeup Tools & Brushes * Beauty Device & Tools * More * Wellness * USDARSEURGBPJPYMXNMYRCADAUDINRAEDBNDCHFEGPHKDIDRIQDJEPMADMWKMVRMURNTDNZDPHPRUBSARSGDSTDSZLSYPTHBTRYTNDTOPTWDVNDYERZMKZARAFNALLAMDANGAOAAWGAZNBAMBBDBDTBGNBHDBIFBMDBOBBRLBSDBTNBWPBYNBYRBZDCDFCLPCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDERNETBFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHNLHRKHTGHUFILSIMPIRRISKJMDJODKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMDLMGAMKDMMKMNTMOPMROMZNNADNGNNIONOKNPROMRPABPENPGKPKRPLNPYGQARRONRSDRWFSBDSCRSDGSEKSHPSLLSOSSPLSRDSVCTJSTMMTMTTTDTVDTZSUAHUGXUYUUZSVEFVUVWSTXAFXAGXAUXBTXCDXDRXOFXPDXPFXPTZMWZWD * Log in * Create account * Search Apply discount codes for single-item purchases at checkout page. YOUR CART0 ITEMS Spend $40 more for FREE shipping.FREE shipping will be applied at checkout Sorry, looks like we don't have enough of this product. Your cart is currently empty. Brands 💝 Today's Deals US Stock Add order notes Special instructions for seller Is this a gift? Add a note. Add a note for recipient Items Free Apply CheckoutFree Volume discounts will be applied during the final checkout. Shipping & taxes calculated at checkout Open navigation menu Open search bar Search for products on our site Open cart My Account Brands VIEW ALL Brands A-Z The SAEM A'PIEU COSRX ETUDE HOUSE Sulwhasoo TONYMOLY HERA LANEIGE MISSHA Krave Innisfree OHUI Benton More + Only At DODO TAMBURINS Bellboy Studio HA'SOL D’ALBA Atomy Dermamular Daleaf 3CE MUZIGAE MANSION Trendy Brands MUZIGAE MANSION D’ALBA A'PIEU AESTURA ANUA AMUSE Beauty of Joseon ROM&ND hince MEDI-PEEL COSRX SKIN1004 ROUND LAB MEDIHEAL Dr.G Torriden Abib 💝 Today's Deals 24HR : TIME DEAL BOGO 1+1 FREE K-BEAUTY UNDER $10 DODOBOX 2024 SPRING SEASON NEAR EXPIRY BIG SALE ROCKET-SPEED SHIPPING🚀 US Stock SKINCARE (US Stock) Moisturizers Suncare Men Baby Special care CLEANSER (US Stock) Exfoliators Cleansing Foam Cleansing Water/Lotion/Tissue Cleansing Oil/Balm Cleansing Cream/Gel Facial Soap & ETC Makeup Remover MAKEUP (US Stock) Face Eye Lip Cheek HAIR & BODY (US Stock) Hair Hand/Foot Tooth Care TOOLS (US Stock) Makeup Tools & Brushes Eyelashes Beauty Device & Tools More Best New In Makeup Face Base/Primer Cushion Pact/Puff Foundation/BB/CC Concealer Powder/Fixer Eye Eyebrow Eyeshadow Eyeliner Mascara Lip Lipstick/Rouge Lip Tint Balm/Gloss Cheek Blush Highlighter Contour Skincare Cleansers Exfoliators Cleansing Foam Cleansing Water/Lotion/Tissue Cleansing Oil/Balm Cleansing Cream/Gel Facial Soap & ETC Makeup Remover Moisturizers Skin/Toner/Mist Lotion/Emulsion Serum Essence/Ampoule Cream/Balm/Gel Facial Oil Eye & Neck Care Lip Care Pack/Mask Set Men Baby Special Care SPF Sun Hair/Body Hair Care Shampoo Conditioner Hair Tonic Treatments/Packs Serum/Essence/Oil/Mist Styling Body Body Care Body Wash/Exfoliators Hand/Foot Tooth Care Perfume/Fragrance Tools Makeup Tools & Brushes Beauty Device & Tools More Wellness Brands VIEW ALL Brands A-Z The SAEM A'PIEU COSRX ETUDE HOUSE Sulwhasoo TONYMOLY HERA LANEIGE MISSHA Krave Innisfree OHUI Benton More + Only At DODO TAMBURINS Bellboy Studio HA'SOL D’ALBA Atomy Dermamular Daleaf 3CE MUZIGAE MANSION Trendy Brands MUZIGAE MANSION D’ALBA A'PIEU AESTURA ANUA AMUSE Beauty of Joseon ROM&ND hince MEDI-PEEL COSRX SKIN1004 ROUND LAB MEDIHEAL Dr.G Torriden Abib 💝 Today's Deals 24HR : TIME DEAL BOGO 1+1 FREE K-BEAUTY UNDER $10 DODOBOX 2024 SPRING SEASON NEAR EXPIRY BIG SALE ROCKET-SPEED SHIPPING🚀 US Stock SKINCARE (US Stock) Moisturizers Suncare Men Baby Special care CLEANSER (US Stock) Exfoliators Cleansing Foam Cleansing Water/Lotion/Tissue Cleansing Oil/Balm Cleansing Cream/Gel Facial Soap & ETC Makeup Remover MAKEUP (US Stock) Face Eye Lip Cheek HAIR & BODY (US Stock) Hair Hand/Foot Tooth Care TOOLS (US Stock) Makeup Tools & Brushes Eyelashes Beauty Device & Tools More Best New In Makeup Face Base/Primer Cushion Pact/Puff Foundation/BB/CC Concealer Powder/Fixer Eye Eyebrow Eyeshadow Eyeliner Mascara Lip Lipstick/Rouge Lip Tint Balm/Gloss Cheek Blush Highlighter Contour Skincare Cleansers Exfoliators Cleansing Foam Cleansing Water/Lotion/Tissue Cleansing Oil/Balm Cleansing Cream/Gel Facial Soap & ETC Makeup Remover Moisturizers Skin/Toner/Mist Lotion/Emulsion Serum Essence/Ampoule Cream/Balm/Gel Facial Oil Eye & Neck Care Lip Care Pack/Mask Set Men Baby Special Care SPF Sun Hair/Body Hair Care Shampoo Conditioner Hair Tonic Treatments/Packs Serum/Essence/Oil/Mist Styling Body Body Care Body Wash/Exfoliators Hand/Foot Tooth Care Perfume/Fragrance Tools Makeup Tools & Brushes Beauty Device & Tools More Wellness Brands VIEW ALL Brands A-Z The SAEM A'PIEU COSRX ETUDE HOUSE Sulwhasoo TONYMOLY HERA LANEIGE MISSHA Krave Innisfree OHUI Benton More + Only At DODO TAMBURINS Bellboy Studio HA'SOL D’ALBA Atomy Dermamular Daleaf 3CE MUZIGAE MANSION Trendy Brands MUZIGAE MANSION D’ALBA A'PIEU AESTURA ANUA AMUSE Beauty of Joseon ROM&ND hince MEDI-PEEL COSRX SKIN1004 ROUND LAB MEDIHEAL Dr.G Torriden Abib 💝 Today's Deals 24HR : TIME DEAL BOGO 1+1 FREE K-BEAUTY UNDER $10 DODOBOX 2024 SPRING SEASON NEAR EXPIRY BIG SALE ROCKET-SPEED SHIPPING🚀 US Stock SKINCARE (US Stock) Moisturizers Suncare Men Baby Special care CLEANSER (US Stock) Exfoliators Cleansing Foam Cleansing Water/Lotion/Tissue Cleansing Oil/Balm Cleansing Cream/Gel Facial Soap & ETC Makeup Remover MAKEUP (US Stock) Face Eye Lip Cheek HAIR & BODY (US Stock) Hair Hand/Foot Tooth Care TOOLS (US Stock) Makeup Tools & Brushes Eyelashes Beauty Device & Tools More Best New In Makeup Face Base/Primer Cushion Pact/Puff Foundation/BB/CC Concealer Powder/Fixer Eye Eyebrow Eyeshadow Eyeliner Mascara Lip Lipstick/Rouge Lip Tint Balm/Gloss Cheek Blush Highlighter Contour Skincare Cleansers Exfoliators Cleansing Foam Cleansing Water/Lotion/Tissue Cleansing Oil/Balm Cleansing Cream/Gel Facial Soap & ETC Makeup Remover Moisturizers Skin/Toner/Mist Lotion/Emulsion Serum Essence/Ampoule Cream/Balm/Gel Facial Oil Eye & Neck Care Lip Care Pack/Mask Set Men Baby Special Care SPF Sun Hair/Body Hair Care Shampoo Conditioner Hair Tonic Treatments/Packs Serum/Essence/Oil/Mist Styling Body Body Care Body Wash/Exfoliators Hand/Foot Tooth Care Perfume/Fragrance Tools Makeup Tools & Brushes Beauty Device & Tools More Wellness Open search bar Search for products on our site My Account Open cart Open search bar Search for products on our site Open cart Open navigation menu 🚀💨 Get an EXTRA 10% OFF our Rocket Delivery Collection! Use code RDFRESH10 🚀💨 Get an EXTRA 10% OFF our Rocket Delivery Collection! Use code RDFRESH10 false UNOVE - A NO-WASH TYPE TREATMENT THAT PROTECTS THE HAIR FROM THERMAL DAMAGE false 3CE - SHY AURA LIQUID BLUSH false BANILA CO - NEW BANILA CO ULTIMATE WHITE CUSHION. false A'PIEU - PURE BLOCK NATURAL DAILY SUN CREAM false CARYOPHY - GENTLE CLEANSING WATER THAT REMOVES MAKEUP AND IMPURITIES WITHOUT IRRITATION false BEAUTY OF JOSEON - CONVENIENTLY USABLE LINE STICK false SAME-DAY ROCKET DISPATCH - USE CODE RDFRESH10 FOR AN EXTRA 10% OFF false MANYO FACTORY - WON THE 2021 BYRDIE AWARD FOR BEST CLEANSING OIL. false AROMATICA - MINERAL SALT EFFECTIVELY REMOVES DEAD SKIN CELLS AND CLEANSES CLOGGED PORE. SUNCARE BODY MOISTURIZERS CLEANSING FOAM/PAD CUSHION PACT/PUFF LIP BEAUTY DEVICE & TOOL HAIR CARE EXPLORE 2024 K-BEAUTY FAVES!💖 + * For your Make-up * K-Clean Beauty * K-Wellness MISSHA M Perfect Cover BB Cream SPF42 PA+++ 50ml #13 #21 #23 #25 #27 - Dodoskin Quick Buy MISSHA (US STOCK)(us stock) missha m perfect cover bb cream spf42 pa+++ 50ml (5 colors) $13.60 $19.72 Save up to 31% IOPE Air Cushion® Cover 15g SPF50+/PA+++ Quick Buy IOPEIope air cushion® cover 15g spf50+/pa+++ From $36.81 Save up to 21% [JUNGSAEMMOOL]Skin Setting Tone Balancing Base 40ml - Dodoskin Quick Buy JUNG SAEM MOOL[expiration imminen] jungsaemmool skin setting tone balancing base 40ml $26.56 $33.46 Save 20% (Mharkr검수) BANILA CO Covericious Ultimate White Cushion SPF38 PA++ 14g - DODOSKIN Quick Buy BANILA COBanila co covericious ultimate white cushion spf38 pa++ 14g $21.20 $32.15 Save up to 34% (Mhark검수) 3CE Sheer Liquid Blusher 5 Colors 3g - DODOSKIN Quick Buy 3CE3ce sheer liquid blusher 5 colors 3g $23.00 $32.54 Save up to 29% (Mhark검수) 3CE Shine Reflector 7 colors 1.7g - DODOSKIN Quick Buy 3CE3ce shine reflector 7 colors 1.7g $16.98 $24.15 Save up to 29% HEIMISH Dailism Smudge Stop Mascara 9g - DODOSKIN Quick Buy HeimishHeimish dailism smudge stop mascara 9g $16.09 $27.58 Save 41% HEIMISH Artless Perfect Cushion 13g - DODOSKIN Quick Buy HeimishHeimish artless perfect cushion 13g $31.35 $42.01 Save up to 25% MERZY The First Creamy Concealer 5.6g (5 shades) - Dodoskin Quick Buy MERZY[expiration is imminen] merzy the first creamy concealer 5.6g (5 shades) $15.11 $22.49 Save up to 32% Only 2 left! EXP 2024.10.12 CLIO Pro Eye Palette AD 0.6g*10ea - Dodoskin Quick Buy CLIO[expiration is imminen] clio pro eye palette ad 0.6g*10ea #12 autumn breeze in seoul forest $19.68 $32.94 Save 40% Only 4 left! EXP 2024.09.23 HEIMISH Artless Glow Base SPF50+PA+++40ml - DODOSKIN Quick Buy HeimishHeimish artless glow base spf50+pa+++40ml $21.99 $29.99 Save 26% HEIMISH Dailism Lip Gloss 4g - 6color - DODOSKIN Quick Buy HeimishHeimish dailism lip gloss 4g - 6color $19.99 $31.00 Save up to 35% CELDERMA Real Gold Hydrogel Eye Patch 4.5gx20ea Quick Buy CELDERMACelderma real gold hydrogel eye patch 4.5gx20ea $20.34 $31.48 Save 35% MEDIHEAL Tea Tree Calming Moisture Toner 350ml - DODOSKIN Quick Buy MEDIHEALMediheal tea tree calming moisture toner 350ml $27.43 $39.48 Save 30% MEDI-PEEL Peptide 9 Volume Tox Cream Pro 50g - DODOSKIN Quick Buy MEDI-PEELMedi-peel peptide 9 volume tox cream pro 50g $16.65 $45.00 Save 63% * 3 days * 17 hrs * 11 mins * 15 secs BENTON Snail Bee High Content Steam Cream 50g - Dodoskin Quick Buy BENTON★time deal★benton snail bee high content steam cream 50g $14.24 $25.55 Save 44% (Matthew검수) CARYOPHY Portulaca Toner 300ml - DODOSKIN Quick Buy CARYOPHYCaryophy portulaca toner 300ml $26.84 $37.81 Save 29% (Matthew검수) CARYOPHY Smart Waterful Cream 40ml - DODOSKIN Quick Buy CARYOPHYCaryophy smart waterful cream 40ml $18.49 $27.54 Save 32% VITAL BEAUTY Super Collagen Gummy 1 Box (40g x 5 Pouch) - DODOSKIN Quick Buy VITAL BEAUTYVital beauty super collagen gummy 1 box (40g x 5 pouch) $27.48 $39.57 Save 30% LACTO-FIT Gold 3box (2g x 150 Sticks) - DODOSKIN Quick Buy LACTO-FITLacto-fit gold 3box (2g x 150 sticks) From $12.54 Save up to 26% (NEWK) Jung Kwan Jang Extract Pills 168g Korean Red Ginseng (168g per bottle X 800 pills) - DODOSKIN Quick Buy JUNG KWAN JANGJung kwan jang extract pills 168g korean red ginseng (168g per bottle x 800 pills) $48.99 $58.42 Save 16% (NEWK) Jung Kwan Jang Vital Tonic Gift Set Box Korean Red Ginseng 1 box (20ml x 10 bottles) - DODOSKIN Quick Buy JUNG KWAN JANGJung kwan jang vital tonic gift set box korean red ginseng 1 box (20ml x 10 bottles) $47.99 $56.84 Save 15% (NEWK) Jung Kwan Jang Jin Go Daily Stick Ginseng Energy - DODOSKIN Quick Buy JUNG KWAN JANGJung kwan jang jin go daily stick ginseng energy 10g x 30ea $45.99 $59.61 Save 22% (NEWK) Jung Kwan Jang Hong Sam Won Pouch Korean Red Ginseng 1 box (50 mL x 20 Pouches) - DODOSKIN Quick Buy JUNG KWAN JANGJung kwan jang hong sam won pouch korean red ginseng 1 box From $32.99 Save up to 13% Jung Kwan Jang Kid Tonic Step 2 (Ages 4-6) Korean Red Ginseng 1 box (20ml 30ea) - DODOSKIN Quick Buy JUNG KWAN JANGJung kwan jang kid tonic step 2 (ages 4-6) korean red ginseng 1 box (20ml 30ea) $111.79 $135.21 Save 17% Jung Kwan Jang Women's Balance Innergetic Jelly Stick Korean Red Ginseng - DODOSKIN Quick Buy JUNG KWAN JANGJung kwan jang women's balance innergetic jelly stick korean red ginseng From $34.99 Save up to 19% FULLight Liveling Pink Cleanse 1Box (15ml x 30ea) - Grapefruit Flavor - DODOSKIN Quick Buy FULLightFullight liveling pink cleanse 1box (15ml x 30ea) - grapefruit flavor $32.99 $45.16 Save 26% Jung Kwan Jang CheonNok Red Ginseng Deer Antler Velvet Extract - DODOSKIN Quick Buy JUNG KWAN JANGJung kwan jang cheonnok red ginseng deer antler velvet extract From $179.99 Save up to 5% Jung Kwan Jang Everytime 3g Extract Stick Korean Red Ginseng (10ml x 30 stick pouches) - DODOSKIN Quick Buy JUNG KWAN JANGJung kwan jang everytime 3g extract stick korean red ginseng (10ml x 30 stick pouches) $79.99 $119.99 Save 33% (NEWK) Jung Kwan Jang Extract Korean Red Ginseng - DODOSKIN Quick Buy JUNG KWAN JANGJung kwan jang extract korean red ginseng $159.99 $176.89 Save 9% TODAY'S K-BEAUTY UPDATES! SHOW MORE CELDERMA Real Gold Hydrogel Eye Patch 4.5gx20ea Quick Buy CELDERMACelderma real gold hydrogel eye patch 4.5gx20ea $20.34 $31.48 Save 35% MEDIHEAL Tea Tree Calming Moisture Toner 350ml - DODOSKIN Quick Buy MEDIHEALMediheal tea tree calming moisture toner 350ml $27.43 $39.48 Save 30% (Mharkr검수) BANILA CO Covericious Ultimate White Cushion SPF38 PA++ 14g - DODOSKIN Quick Buy BANILA COBanila co covericious ultimate white cushion spf38 pa++ 14g $21.20 $32.15 Save up to 34% MEDI-PEEL Peptide 9 Volume Tox Cream Pro 50g - DODOSKIN Quick Buy MEDI-PEELMedi-peel peptide 9 volume tox cream pro 50g $16.65 $45.00 Save 63% salTherapy Dr.Noitchy Scalp Shampoo 290ml - DODOSKIN Quick Buy salTherapySaltherapy dr.noitchy scalp shampoo 290ml $30.79 $42.18 Save 27% (Mhark검수) 3CE Sheer Liquid Blusher 5 Colors 3g - DODOSKIN Quick Buy 3CE3ce sheer liquid blusher 5 colors 3g $23.00 $32.54 Save up to 29% (Mhark검수) 3CE Shine Reflector 7 colors 1.7g - DODOSKIN Quick Buy 3CE3ce shine reflector 7 colors 1.7g $16.98 $24.15 Save up to 29% CARYOPHY Smart Cleansing Water 500ml Quick Buy CARYOPHYCaryophy smart cleansing water 500ml $25.45 $34.75 Save 26% (Matthew검수) CARYOPHY Portulaca Mask Sheet 22g 10ea - DODOSKIN Quick Buy CARYOPHYCaryophy portulaca mask sheet 22gx10ea $23.45 $32.18 Save 27% (Matthew검수) CARYOPHY Portulaca Cleansing Foam 150ml - DODOSKIN Quick Buy CARYOPHYCaryophy portulaca cleansing foam 150ml $22.34 $31.34 Save 28% (Matthew검수) CARYOPHY Portulaca Toner 300ml - DODOSKIN Quick Buy CARYOPHYCaryophy portulaca toner 300ml $26.84 $37.81 Save 29% (Matthew검수) CARYOPHY Smart Peeling Gel 250ml - DODOSKIN Quick Buy CARYOPHYCaryophy smart peeling gel 250ml $21.57 $30.84 Save 30% CARYOPHY Glass Skin Cleansing Foam 120ml - DODOSKIN Quick Buy CARYOPHYCaryophy glass skin cleansing foam 120ml $30.34 $39.21 Save 22% (Matthew검수) CARYOPHY Smart Waterful Cream 40ml - DODOSKIN Quick Buy CARYOPHYCaryophy smart waterful cream 40ml $18.49 $27.54 Save 32% CARYOPHY Glass Skin Serum 50ml - DODOSKIN Quick Buy CARYOPHYCaryophy glass skin serum 50ml $34.12 $42.18 Save 19% CARYOPHY Glass Skin Toner 120ml - DODOSKIN Quick Buy CARYOPHYCaryophy glass skin toner 120ml $32.74 $40.15 Save 18% (Matthew검수) CARYOPHY Skin Repair Cream 50ml - DODOSKIN Quick Buy CARYOPHYCaryophy skin repair cream 50ml $33.01 $42.35 Save 22% (Matthew검수) CARYOPHY Skin Repair Serum 50ml - DODOSKIN Quick Buy CARYOPHYCaryophy skin repair serum 50ml $32.45 $41.50 Save 21% Hanyul Geuk Jin Cream 50ml - DODOSKIN Quick Buy HanyulHanyul geuk jin cream 50ml $127.68 $154.18 Save 17% (Mhark) APLB Salicylic Acid BHA Arbutin Ampoule Serum 40ml - DODOSKIN Quick Buy APLBAplb salicylic acid bha arbutin ampoule serum 40ml $16.95 $25.17 Save 32% Hanyul Powerful Bean Firming Serum 30ml - DODOSKIN Quick Buy HanyulHanyul powerful bean firming serum 30ml $20.21 $31.51 Save 35% Hanyul Red Rice Moisture Firming Wrapping Mask Sheet 20ml *10ea - DODOSKIN Quick Buy HanyulHanyul red rice moisture firming wrapping mask sheet 20ml *10ea $26.37 $34.58 Save 23% Hanyul Song Dam Firming Skin 150ml - DODOSKIN Quick Buy HanyulHanyul song dam firming skin 150ml $30.43 $41.25 Save 26% HANYUL Yuja Brightening Wrapping Mask Sheet 20ml*10ea - DODOSKIN Quick Buy HanyulHanyul yuja brightening wrapping mask sheet 20ml*10ea $22.81 $31.25 Save 27% Hanyul Geuk Jin Essence 50ml - DODOSKIN Quick Buy HanyulHanyul geuk jin essence 50ml $117.49 $146.84 Save 19% Hanyul Pure Artemisia Calming Wrapping Mask 20ml *10ea - DODOSKIN Quick Buy HanyulHanyul pure artemisia calming wrapping mask 20ml *10ea $22.81 $31.25 Save 27% HEIMISH Dailism Smudge Stop Mascara 9g - DODOSKIN Quick Buy HeimishHeimish dailism smudge stop mascara 9g $16.09 $27.58 Save 41% K-BEAUTY BEST SELLERS Show More Anua Cleansing SET (Heartleaf Cleansing Oil+Heartleaf Quercetinol Foam) - DODOSKIN Quick Buy ANUAAnua cleansing set (cleansing oil+foam) $49.99 $65.98 Save up to 24% ma:nyo Pure Cleansing Oil 200ml - Dodoskin Quick Buy MANYO FACTORYManyo factory pure cleansing oil 200ml $25.31 $36.98 5.0 Save 31% 72 Available BANILA CO Clean it Zero Cleansing Balm Makeup Remover Sherbet 125ml - Dodoskin Quick Buy BANILA COBanila co clean it zero cleansing balm 100ml $11.98 $30.00 5.0 Save 60% Sulwhasoo New Perfecting Cushion 15g x 2 SPF50+/PA+++ (Original + Refill) - 8 Colors - DODOSKIN Quick Buy SulwhasooSulwhasoo new perfecting cushion 15g x 2 spf50+/pa+++ (original + refill) - 8 colors From $51.99 Save up to 37% ROM&ND Glasting Color Gloss 4g - 6 Colors - DODOSKIN Quick Buy ROM&NDRom&nd glasting color gloss 4g - 6 colors $16.81 $25.66 Save up to 34% THE FACE SHOP Rice Water Bright Cleansing Light / Rich Oil 150ml - Dodoskin Quick Buy THE FACE SHOPThe face shop rice water bright cleansing light / rich oil 150ml From $10.29 5.0 Save up to 27% AESTURA AtoBarrier365 Cream Mist 120ml - DODOSKIN Quick Buy AESTURAAestura atobarrier365 cream mist 120ml $21.98 $30.48 Save 27% COSRX Oil Free Ultra Moisturizing Lotion 100ml - Dodoskin Quick Buy COSRXCosrx oil free ultra moisturizing lotion 100ml $19.20 $29.99 5.0 Save 35% BRAND MEDICUBE Korean Beauty Tech Device. Shop Now COLLECTION K-MAKE UP SHOP NOW SPECIAL KOREAN BEAUTY CUSHION Show More BRAND TAMBURINS Shop Now K-BEAUTY BRANDS & STORIES AEGYO-SAL MAGIC: PUFF IT UP WITH KOREA'S CUTEST UNDER-EYE BAG BEAUTY CRAZE! March 25, 2024 Dive into the adorable world of aegyo-sal, the beauty secret straight from South Korea that's all about celebrating those cute little puffs under your eyes! Yes, you read that right. While many of us are... AMUSE DEW LIP TINT: TIPS & TRICKS March 23, 2024 What is Amuse Dew Lip Tint? Amuse Dew Lip Tint is a beauty product that offers a lightweight, watery texture and a high-gloss finish, making it ideal for achieving a dewy lip look. Infused with... EVERYTHING YOU NEED TO KNOW ABOUT NUMBUZIN NO.5 NIACINAMIDE CONCENTRATED TONER PAD March 21, 2024 1. Numbuzin No.5 Niacinamide Toner Pads Numbuzin No.5 Niacinamide Toner Pads are a game-changer in your skincare routine. These toner pads are infused with the power of niacinamide, a form of vitamin B3 known for... DODGERS PLAYERS WIVES ENJOY K-BEAUTY HAUL IN SEOUL March 19, 2024 While in Seoul for the Major League Baseball World Tour Seoul Series, a group of Los Angeles Dodgers players' wives embarked on an impromptu K-beauty exploration. Approximately 10 spouses, including Dasha Outman and Cara Smith,... View all posts WHO USES WHAT? DISCOVERING K-POP & CELEBRITY BEAUTY FAVORITES THE ENDURING CHARM OF BAE SUZY: SOUTH KOREA'S DARLING OF CLEAN BEAUTY April 08, 2024 Image source @SBS In the ever-evolving world of South Korean entertainment, few stars have shone as brightly and consistently as Bae Suzy. Known mononymously as Suzy, her journey from being a member of the popular girl... LE SSERAFIM'S SAKURA SHARES HER KOREAN SKINCARE AND BEAUTY TIPS WITH VOGUE March 13, 2024 LE SSERAFIM'S SAKURA Korean Skincare Regimen In the feature, LE SSERAFIM's SAKURA delves into her beauty and skincare regimen, emphasizing her minimalist makeup approach and her journey towards achieving her signature glow. She begins by... STRAY KIDS' FELIX GLOWS IN VOGUE KOREA'S FEBRUARY 2024 ISSUE, FEATURING LANEIGE LIP SLEEPING MASK February 28, 2024 In the dazzling February 2024 issue of Vogue Korea, Felix of Stray Kids not only captivates with his striking visuals and impeccable fashion sense but also brings to light the Laneige Lip Sleeping... View all posts K-BEAUTY DODO PROMOTIONS BEAUTY OF JOSEON MATTE SUN STICK SALE EVENT April 15, 2024 Beauty of Joseon Matte Sun Stick Sale EventAPR 15 - APR 24, 2024 PST UNOVE HEATING GUARD NO-WASH TREATMENT SALE EVENT April 15, 2024 UNOVE Heating Guard No-Wash Treatment Sale EventAPR 15 - APR 24, 2024 PST A'PIEU PURE BLOCK NATURAL DAILY SUN CREAM SALE EVENT April 15, 2024 A'PIEU Pure Block Natural Daily Sun Cream Sale EventAPR 15 - APR 24, 2024 PST TOO COOL FOR SCHOOL SALE EVENT **END April 04, 2024 Too Cool For School Sale EventAPR 4 - APR 14, 2024 PST View all posts FEATURED IN THE BRANDS WITH LOVE! TIKTOK : CUSTOMER HAPPINESS EFFORTS BEHIND-THE-SCENES! ❮ ❯ NEWSLETTER Sign up for exclusive deals and early access to new products. Sign up Email is invalid or already taken. LET CUSTOMERS SPEAK FOR US from 9400 reviews Verified by wow Quick and efficient! Medicube AGE-R Booster Pro was at my doorstep in no time. The fast delivery exceeded my expectations. Great job! Anna L. Medicube AGE-R Booster Pro 03/13/2024 Repaired my skin! Used this for a year and it took awhile but eventually applying this twice a day helped clear my scars and blemishes. 10/10 recommend! C. SOME BY MI Snail Truecica Miracle Repair Cream 60g 02/29/2024 Wonderful product My sister uses this on a daily basis, I don't due to laziness forgetfulness, but we have both purchased this twice. I have combi skin so the formulation works for me. C. ETUDE HOUSE Sunprise Mild Watery Light SPF50+/PA++++ 50g 02/29/2024 Works well I’m actually repurchasing this one god is so freaking good and it’s so big too it last so long cause a little goes a long way and it does so good for my skin it makes it so glow just the best thing that happened to me. E.M. SKIN1004 Madagascar Centella Toning Toner 210ml 02/27/2024 Nice product I got this product as a daily free gift and forgot to review it! But this one of the best cleansing wipes I've ever used. It refreshed my skin and definitely feels softer after using it and it did not dry my skin. I just wished there was more in the packet but I will definitely be buying some more! pappu l. THE FACE SHOP Herb Day Cleansing Tissue (70sheets) 02/25/2024 Great The size of the pack is bulkier than I expected bigger than the plus size iPhone, but it does its job well. I would use this when travelling but if you can find so, etching in a smaller size that would be better. J.K. THE FACE SHOP Herb Day Cleansing Tissue (70sheets) 02/25/2024 In love with these! Got this as a daily free gift, and wow these cleansing tissue was the best, it wasn't drying, and face gets really soft after you've use it. We'll definitely buy for more! Kudsia THE FACE SHOP Herb Day Cleansing Tissue (70sheets) 02/25/2024 2nd time purchasing I was glad to find this on here as I'd bought my previous one in person. very lightweight, creamy, but leaves my skin feeling dewy especially combined with the toner and serum. A. THE FACE SHOP The Therapy Royal Made Moisture Blending Formula Cream 50ml 02/25/2024 Seller review is that it arrived quickly within a week from ordering overseas. Device review still a bit early to decide but it pairs well with the app and offers a good routine if you are not sure about what to do. Marwa Medicube AGE-R Booster Pro 01/12/2024 About * About us * Contact * Notice * Affiliate & Ambassador * Wholesale B2B Help * Shipping Policy * Return & Exchange * Notice * FAQ My Account * Cart * Order History * My Account Our Policies * Privacy Policy * Terms and Conditions * Accessibility Newsletter Stay up to date with the new collections, products and exclusive offers. Subscribe to Our Newsletter Email is invalid or already taken. LANGUAGE English * English * français * 日本語 * Español * العربية * Deutsch CURRENCY USD $ * AED د.إ * AFN ؋ * ALL L * AMD դր. * ANG ƒ * ARS $ * AUD $ * AWG ƒ * AZN ₼ * BAM КМ * BBD $ * BDT ৳ * BGN лв. * BIF Fr * BND $ * BOB Bs. * BRL R$ * BSD $ * BWP P * BZD $ * CAD $ * CDF Fr * CHF CHF * CNY ¥ * CRC ₡ * CVE $ * CZK Kč * DJF Fdj * DKK kr. * DOP $ * DZD د.ج * EGP ج.م * ETB Br * EUR € * FJD $ * FKP £ * GBP £ * GMD D * GNF Fr * GTQ Q * GYD $ * HKD $ * HNL L * HUF Ft * IDR Rp * ILS ₪ * INR ₹ * ISK kr * JMD $ * JPY ¥ * KES KSh * KGS som * KHR ៛ * KMF Fr * KYD $ * KZT 〒 * LAK ₭ * LBP ل.ل * LKR ₨ * MAD د.م. * MDL L * MKD ден * MNT ₮ * MOP P * MUR ₨ * MVR MVR * MWK MK * MXN $ * MYR RM * NGN ₦ * NIO C$ * NPR ₨ * NZD $ * PEN S/. * PGK K * PHP ₱ * PKR ₨ * PLN zł * PYG ₲ * QAR ر.ق * RON Lei * RSD РСД * RWF FRw * SAR ر.س * SBD $ * SEK kr * SGD $ * SHP £ * SLL Le * STD Db * THB ฿ * TJS ЅМ * TOP T$ * TTD $ * TWD $ * TZS Sh * UAH ₴ * UGX USh * USD $ * UYU $ * UZS * VND ₫ * VUV Vt * WST T * XAF Fr * XCD $ * XOF Fr * XPF Fr * YER ﷼ © 2024, DODOGLOBAL, Inc. All rights reserved. cs@dodoskin.com * Amazon * American Express * Apple Pay * Diners Club * Discover * Meta Pay * Google Pay * Mastercard * PayPal * Shop Pay * Venmo * Visa Close Close {"themeColor":"#000000","iconColor":"#000000","showLogo":true,"topBottomPosition":10,"rightLeftPosition":10,"iconSize":"extra-small","iconCustomSize":27,"position":"bottom-left"} by HIKO ☺ Judge.me ← X → Receive an extra 5% off as a welcome bonus & a birthday gift ! Extra 5%OFF your first order Unlock your exclusive K-beauty adventure here! Delve into a world of special bonuses and your personal secret code, waiting just for you. CONTINUE