www.yoursparkleluxe.com
Open in
urlscan Pro
54.154.42.22
Public Scan
Submitted URL: https://yoursparkleluxe.com/
Effective URL: https://www.yoursparkleluxe.com/
Submission: On April 28 via api from US — Scanned from DE
Effective URL: https://www.yoursparkleluxe.com/
Submission: On April 28 via api from US — Scanned from DE
Form analysis
1 forms found in the DOMGET https://www.yoursparkleluxe.com/index.aspx?pageid=UJShb
<form action="https://www.yoursparkleluxe.com/index.aspx?pageid=UJShb" method="get"><input name="pageid" id="pageid" type="hidden" value="UJShb"><input name="chainID" id="chainID" type="hidden" value="932528">
<div class="search" data-editor-type="search">
<input id="txtQuickSearch" name="txtQuickSearch" placeholder="search" aria-label="search">
<button aria-label="search"><i class="fa fa-search" aria-hidden="true"></i></button>
</div>
</form>
Text Content
Product Added to your Cart x proceed to checkout -------- OR -------- continue shopping continue shopping Menu HomeAboutCartContactOffers Categories Earring’s USD AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL $0.00 My Account HomeAboutCartContactOffers Categories Earring’s Earring’s Featured Products Swarovski Elements Dangle Earring's $25.00 Shop my earring's, Great Prices. Store Links TermsPrivacySitemap Follow Us © 2024. Erin Peterson | ie9+ | Free ecommerce store MODAL DIALOG TITLE Modal Dialog Content Cancel Ok Create a free online store Powered by freewebstore.com Get your free online store today - Be your own boss! freewebstore Got a great business idea? Get a free online store just like this one! What do I get? Fully loaded webstore Unlimited products Domain & SSL checkout 24/7 support And more... Why freewebstore? 15+ years 1 million stores created No card required Easy to create What's the catch? Nope, no catch 0% commission Free forever! Premium upgrades available Get Started i ? Want a free online store like this one? - click here freewebstore