www.companyspotter.com
Open in
urlscan Pro
2a06:98c1:3120::3
Public Scan
Submitted URL: https://www.companyspotter.eu/
Effective URL: https://www.companyspotter.com/
Submission: On August 23 via manual from DE — Scanned from DE
Effective URL: https://www.companyspotter.com/
Submission: On August 23 via manual from DE — Scanned from DE
Form analysis 3 forms found in the DOM
<form class="mb-6 ng-pristine ng-valid ng-valid-email" ng-submit="vm.login()">
<div class="modal-body px-lg-8">
<div class="form-group mb-3"><label class="form-label mb-0" for="email"> Email Address </label> <input id="loginModalEmail" type="email" class="form-control bg-gray bg-opacity-10 ng-pristine ng-untouched ng-valid ng-empty ng-valid-email"
ng-model="vm.credentials.username" placeholder=""></div>
<div class="form-group mb-5"><label class="form-label mb-0" for="password"> Password </label> <input type="password" class="form-control bg-gray bg-opacity-10 ng-pristine ng-untouched ng-valid ng-empty" ng-model="vm.credentials.password"
placeholder=""> <small><a href="/user/password-reset">Forgot password?</a></small></div>
</div>
<div class="modal-footer flex-column">
<p class="text-center"><button class="btn btn-dark fw-semi-bold" type="submit"> Login </button></p><!-- ngIf: vm.error.length > 0 --><!-- ngIf: vm.linkSent -->
<p><small> No account yet? <a class="decorated" href="#" data-bs-dismiss="modal" data-bs-toggle="modal" data-bs-target="#registerModal">Register</a> </small></p>
</div>
</form><form class="mb-6 ng-pristine ng-invalid ng-invalid-required ng-valid-email" ng-submit="vm.register()">
<div class="modal-body px-lg-6 animated"><!-- ngIf: vm.success --><!-- ngIf: !vm.success -->
<div ng-if="!vm.success" class="ng-scope">
<div class="row">
<div class="form-group mb-2 col-6"><label class="form-label mb-0" for="firstName"> First name </label> <input id="firstName" type="text"
class="form-control bg-gray bg-opacity-10 ng-pristine ng-untouched ng-empty ng-invalid ng-invalid-required" ng-model="vm.credentials.firstName" placeholder="" required=""></div>
<div class="form-group mb-2 col-6"><label class="form-label mb-0" for="lastName"> Last name </label> <input id="lastName" type="text" class="form-control bg-gray bg-opacity-10 ng-pristine ng-untouched ng-empty ng-invalid ng-invalid-required"
ng-model="vm.credentials.lastName" placeholder="" required=""></div>
</div>
<div class="row">
<div class="form-group mb-2 col-8"><label class="form-label mb-0" for="email"> Email Address </label> <input id="email" type="email"
class="form-control bg-gray bg-opacity-10 ng-pristine ng-untouched ng-empty ng-valid-email ng-invalid ng-invalid-required" ng-model="vm.credentials.username" placeholder="" required=""></div>
<div class="form-group mb-2 col-4"><label class="form-label mb-0" for="country"> Country </label> <select id="country" class="form-control bg-gray bg-opacity-10 " ng-model="vm.credentials.country" placeholder=""
ng-options="a.code for a in vm.countries" required="">
<option label="AF" value="object:17">AF</option>
<option label="AL" value="object:18">AL</option>
<option label="DZ" value="object:19">DZ</option>
<option label="AS" value="object:20">AS</option>
<option label="AD" value="object:21">AD</option>
<option label="AO" value="object:22">AO</option>
<option label="AI" value="object:23">AI</option>
<option label="AQ" value="object:24">AQ</option>
<option label="AG" value="object:25">AG</option>
<option label="AR" value="object:26">AR</option>
<option label="AM" value="object:27">AM</option>
<option label="AW" value="object:28">AW</option>
<option label="AU" value="object:29">AU</option>
<option label="AT" value="object:30">AT</option>
<option label="AZ" value="object:31">AZ</option>
<option label="BS" value="object:32">BS</option>
<option label="BH" value="object:33">BH</option>
<option label="BD" value="object:34">BD</option>
<option label="BB" value="object:35">BB</option>
<option label="BY" value="object:36">BY</option>
<option label="BE" value="object:37">BE</option>
<option label="BZ" value="object:38">BZ</option>
<option label="BJ" value="object:39">BJ</option>
<option label="BM" value="object:40">BM</option>
<option label="BT" value="object:41">BT</option>
<option label="BO" value="object:42">BO</option>
<option label="BA" value="object:43">BA</option>
<option label="BW" value="object:44">BW</option>
<option label="BR" value="object:45">BR</option>
<option label="IO" value="object:46">IO</option>
<option label="VG" value="object:47">VG</option>
<option label="BN" value="object:48">BN</option>
<option label="BG" value="object:49">BG</option>
<option label="BF" value="object:50">BF</option>
<option label="BI" value="object:51">BI</option>
<option label="KH" value="object:52">KH</option>
<option label="CM" value="object:53">CM</option>
<option label="CA" value="object:54">CA</option>
<option label="CV" value="object:55">CV</option>
<option label="KY" value="object:56">KY</option>
<option label="CF" value="object:57">CF</option>
<option label="TD" value="object:58">TD</option>
<option label="CL" value="object:59">CL</option>
<option label="CN" value="object:60">CN</option>
<option label="CX" value="object:61">CX</option>
<option label="CC" value="object:62">CC</option>
<option label="CO" value="object:63">CO</option>
<option label="KM" value="object:64">KM</option>
<option label="CK" value="object:65">CK</option>
<option label="CR" value="object:66">CR</option>
<option label="HR" value="object:67">HR</option>
<option label="CU" value="object:68">CU</option>
<option label="CW" value="object:69">CW</option>
<option label="CY" value="object:70">CY</option>
<option label="CZ" value="object:71">CZ</option>
<option label="CD" value="object:72">CD</option>
<option label="DK" value="object:73">DK</option>
<option label="DJ" value="object:74">DJ</option>
<option label="DM" value="object:75">DM</option>
<option label="DO" value="object:76">DO</option>
<option label="TL" value="object:77">TL</option>
<option label="EC" value="object:78">EC</option>
<option label="EG" value="object:79">EG</option>
<option label="SV" value="object:80">SV</option>
<option label="GQ" value="object:81">GQ</option>
<option label="ER" value="object:82">ER</option>
<option label="EE" value="object:83">EE</option>
<option label="ET" value="object:84">ET</option>
<option label="FK" value="object:85">FK</option>
<option label="FO" value="object:86">FO</option>
<option label="FJ" value="object:87">FJ</option>
<option label="FI" value="object:88">FI</option>
<option label="FR" value="object:89">FR</option>
<option label="PF" value="object:90">PF</option>
<option label="GA" value="object:91">GA</option>
<option label="GM" value="object:92">GM</option>
<option label="GE" value="object:93">GE</option>
<option label="DE" value="object:94">DE</option>
<option label="GH" value="object:95">GH</option>
<option label="GI" value="object:96">GI</option>
<option label="GR" value="object:97">GR</option>
<option label="GL" value="object:98">GL</option>
<option label="GD" value="object:99">GD</option>
<option label="GU" value="object:100">GU</option>
<option label="GT" value="object:101">GT</option>
<option label="GG" value="object:102">GG</option>
<option label="GN" value="object:103">GN</option>
<option label="GW" value="object:104">GW</option>
<option label="GY" value="object:105">GY</option>
<option label="HT" value="object:106">HT</option>
<option label="HN" value="object:107">HN</option>
<option label="HK" value="object:108">HK</option>
<option label="HU" value="object:109">HU</option>
<option label="IS" value="object:110">IS</option>
<option label="IN" value="object:111">IN</option>
<option label="ID" value="object:112">ID</option>
<option label="IR" value="object:113">IR</option>
<option label="IQ" value="object:114">IQ</option>
<option label="IE" value="object:115">IE</option>
<option label="IM" value="object:116">IM</option>
<option label="IL" value="object:117">IL</option>
<option label="IT" value="object:118">IT</option>
<option label="CI" value="object:119">CI</option>
<option label="JM" value="object:120">JM</option>
<option label="JP" value="object:121">JP</option>
<option label="JE" value="object:122">JE</option>
<option label="JO" value="object:123">JO</option>
<option label="KZ" value="object:124">KZ</option>
<option label="KE" value="object:125">KE</option>
<option label="KI" value="object:126">KI</option>
<option label="XK" value="object:127">XK</option>
<option label="KW" value="object:128">KW</option>
<option label="KG" value="object:129">KG</option>
<option label="LA" value="object:130">LA</option>
<option label="LV" value="object:131">LV</option>
<option label="LB" value="object:132">LB</option>
<option label="LS" value="object:133">LS</option>
<option label="LR" value="object:134">LR</option>
<option label="LY" value="object:135">LY</option>
<option label="LI" value="object:136">LI</option>
<option label="LT" value="object:137">LT</option>
<option label="LU" value="object:138">LU</option>
<option label="MO" value="object:139">MO</option>
<option label="MK" value="object:140">MK</option>
<option label="MG" value="object:141">MG</option>
<option label="MW" value="object:142">MW</option>
<option label="MY" value="object:143">MY</option>
<option label="MV" value="object:144">MV</option>
<option label="ML" value="object:145">ML</option>
<option label="MT" value="object:146">MT</option>
<option label="MH" value="object:147">MH</option>
<option label="MR" value="object:148">MR</option>
<option label="MU" value="object:149">MU</option>
<option label="YT" value="object:150">YT</option>
<option label="MX" value="object:151">MX</option>
<option label="FM" value="object:152">FM</option>
<option label="MD" value="object:153">MD</option>
<option label="MC" value="object:154">MC</option>
<option label="MN" value="object:155">MN</option>
<option label="ME" value="object:156">ME</option>
<option label="MS" value="object:157">MS</option>
<option label="MA" value="object:158">MA</option>
<option label="MZ" value="object:159">MZ</option>
<option label="MM" value="object:160">MM</option>
<option label="NA" value="object:161">NA</option>
<option label="NR" value="object:162">NR</option>
<option label="NP" value="object:163">NP</option>
<option label="NL" value="object:164">NL</option>
<option label="AN" value="object:165">AN</option>
<option label="NC" value="object:166">NC</option>
<option label="NZ" value="object:167">NZ</option>
<option label="NI" value="object:168">NI</option>
<option label="NE" value="object:169">NE</option>
<option label="NG" value="object:170">NG</option>
<option label="NU" value="object:171">NU</option>
<option label="KP" value="object:172">KP</option>
<option label="MP" value="object:173">MP</option>
<option label="NO" value="object:174">NO</option>
<option label="OM" value="object:175">OM</option>
<option label="PK" value="object:176">PK</option>
<option label="PW" value="object:177">PW</option>
<option label="PS" value="object:178">PS</option>
<option label="PA" value="object:179">PA</option>
<option label="PG" value="object:180">PG</option>
<option label="PY" value="object:181">PY</option>
<option label="PE" value="object:182">PE</option>
<option label="PH" value="object:183">PH</option>
<option label="PN" value="object:184">PN</option>
<option label="PL" value="object:185">PL</option>
<option label="PT" value="object:186">PT</option>
<option label="PR" value="object:187">PR</option>
<option label="QA" value="object:188">QA</option>
<option label="CG" value="object:189">CG</option>
<option label="RE" value="object:190">RE</option>
<option label="RO" value="object:191">RO</option>
<option label="RU" value="object:192">RU</option>
<option label="RW" value="object:193">RW</option>
<option label="BL" value="object:194">BL</option>
<option label="SH" value="object:195">SH</option>
<option label="KN" value="object:196">KN</option>
<option label="LC" value="object:197">LC</option>
<option label="MF" value="object:198">MF</option>
<option label="PM" value="object:199">PM</option>
<option label="VC" value="object:200">VC</option>
<option label="WS" value="object:201">WS</option>
<option label="SM" value="object:202">SM</option>
<option label="ST" value="object:203">ST</option>
<option label="SA" value="object:204">SA</option>
<option label="SN" value="object:205">SN</option>
<option label="RS" value="object:206">RS</option>
<option label="SC" value="object:207">SC</option>
<option label="SL" value="object:208">SL</option>
<option label="SG" value="object:209">SG</option>
<option label="SX" value="object:210">SX</option>
<option label="SK" value="object:211">SK</option>
<option label="SI" value="object:212">SI</option>
<option label="SB" value="object:213">SB</option>
<option label="SO" value="object:214">SO</option>
<option label="ZA" value="object:215">ZA</option>
<option label="KR" value="object:216">KR</option>
<option label="SS" value="object:217">SS</option>
<option label="ES" value="object:218">ES</option>
<option label="LK" value="object:219">LK</option>
<option label="SD" value="object:220">SD</option>
<option label="SR" value="object:221">SR</option>
<option label="SJ" value="object:222">SJ</option>
<option label="SZ" value="object:223">SZ</option>
<option label="SE" value="object:224">SE</option>
<option label="CH" value="object:225">CH</option>
<option label="SY" value="object:226">SY</option>
<option label="TW" value="object:227">TW</option>
<option label="TJ" value="object:228">TJ</option>
<option label="TZ" value="object:229">TZ</option>
<option label="TH" value="object:230">TH</option>
<option label="TG" value="object:231">TG</option>
<option label="TK" value="object:232">TK</option>
<option label="TO" value="object:233">TO</option>
<option label="TT" value="object:234">TT</option>
<option label="TN" value="object:235">TN</option>
<option label="TR" value="object:236">TR</option>
<option label="TM" value="object:237">TM</option>
<option label="TC" value="object:238">TC</option>
<option label="TV" value="object:239">TV</option>
<option label="VI" value="object:240">VI</option>
<option label="UG" value="object:241">UG</option>
<option label="UA" value="object:242">UA</option>
<option label="AE" value="object:243">AE</option>
<option label="GB" value="object:244">GB</option>
<option label="US" value="object:245" selected="selected">US</option>
<option label="UY" value="object:246">UY</option>
<option label="UZ" value="object:247">UZ</option>
<option label="VU" value="object:248">VU</option>
<option label="VA" value="object:249">VA</option>
<option label="VE" value="object:250">VE</option>
<option label="VN" value="object:251">VN</option>
<option label="WF" value="object:252">WF</option>
<option label="EH" value="object:253">EH</option>
<option label="YE" value="object:254">YE</option>
<option label="ZM" value="object:255">ZM</option>
<option label="ZW" value="object:256">ZW</option>
</select></div>
</div>
<div class="form-group mb-2"><label class="form-label mb-0" for="password"> Password </label> <input id="password" type="password" class="form-control bg-gray bg-opacity-10 ng-pristine ng-untouched ng-empty ng-invalid ng-invalid-required"
ng-model="vm.credentials.password" placeholder="" required=""></div>
<div class="form-group mb-2 mb-5"><label class="form-label mb-0" for="passwordRepeat"> Repeat password </label> <input id="passwordRepeat" type="password"
class="form-control bg-gray bg-opacity-10 ng-pristine ng-untouched ng-empty ng-invalid ng-invalid-required" ng-model="vm.passwordRepeat" placeholder="" required=""></div>
<div class="form-check"><input class="form-check-input ng-pristine ng-untouched ng-empty ng-invalid ng-invalid-required" type="checkbox" ng-model="vm.acceptTerms" id="termsConditionsCheck" required=""> <label class="form-check-label"
for="termsConditionsCheck"> Yes, I have read and I accept <a ng-href="/terms" class="decorated fw-normal" href="/terms">the Terms of Use</a>. </label></div>
<div class="form-check"><input class="form-check-input ng-pristine ng-untouched ng-empty ng-invalid ng-invalid-required" type="checkbox" ng-model="vm.acceptPrivacy" id="termsPrivacyCheck" required=""> <label class="form-check-label"
for="termsPrivacyCheck"> Yes, I have read and I accept the <a ng-href="/privacy-center" class="decorated fw-normal" href="/privacy-center">Privacy Statements</a>. </label></div>
</div><!-- end ngIf: !vm.success -->
</div><!-- ngIf: !vm.success -->
<div class="modal-footer flex-column ng-scope" ng-if="!vm.success">
<p class="text-center"><button class="btn btn-dark fw-semi-bold" type="submit" ng-disabled="vm.registering"> Register<!-- ngIf: vm.registering --></button></p><!-- ngIf: vm.error -->
<p><small> Already have an account? <a ng-href="#" class="decorated" data-bs-dismiss="modal" data-bs-toggle="modal" data-bs-target="#loginModal" style="cursor:pointer" href="#">Log in</a> </small></p>
</div><!-- end ngIf: !vm.success -->
</form><form ng-submit="vm.advancedQuery.length > 0 ? vm.expertSearch() : vm.search(vm.searchOptions[0])" id="searchBarContainer" class="rounded bg-white shadow py-2 px-4">
<div class="d-flex justify-content-between align-items-center"><i ng-hide="vm.isEmbedded" class="fas fa-info ms-1 p-2 position-absolute" data-bs-toggle="tooltip" data-bs-placement="left" aria-label="
Enter your search here and choose the way you want to search from the pull-down menu. Then click 'search' to start your search.
In most cases, you can click the [+] icon to combine several searches and search very specifically.
If you want even more control over your search results, you can add a - (minus sign) to use as a negative filter (like a NOT). Or go even further and click on AND to convert it to an OR and refine your searches even further.
" data-bs-original-title="
Enter your search here and choose the way you want to search from the pull-down menu. Then click 'search' to start your search.
In most cases, you can click the [+] icon to combine several searches and search very specifically.
If you want even more control over your search results, you can add a - (minus sign) to use as a negative filter (like a NOT). Or go even further and click on AND to convert it to an OR and refine your searches even further.
"></i> <i ng-hide="!vm.isEmbedded" class="fas fa-search position-absolute ms-3 ng-hide"></i> <input type="text" id="searchBar" autofocus=""
class="search-input d-inline bg-transparent border-0 w-100 p-4 px-5 ng-pristine ng-untouched ng-valid ng-empty" placeholder="Search URL, keywords, technologies or company name" ng-model-options="{'debounce':150}" ng-change="vm.preview()"
ng-model="vm.input" ng-keyup="$event.keyCode == 32 && vm.checkExpert()"
ng-keydown="$event.keyCode == 8 && vm.input.length == 0 && vm.advancedQuery.length > 0 && vm.removeAdvanced(vm.advancedQuery[vm.advancedQuery.length-1])"> <button ng-hide="vm.isEmbedded" type="submit"
class="btn btn-dark text-white fw-semi-bold d-none d-md-inline-block"> Search </button></div>
<div class="animated" style="position: relative;"><!-- ngRepeat: q in vm.advancedQuery --></div>
</form>Text Content
* Services
* Website Checker
Find company information based on URLs
* Keyword search
Find companies based on keywords
* Industry search
Find companies based on industries
* Search by technology
Find companies based on technologies
* Search for companies
Find companies by company name
* Search by location
Find companies based on their location
* Expert search
Combine all features and search like an expert
* Lead lists
Create your own custom lead list
* Pricing
* Resources
* Industries
* Technologies
* Database
* Numbers
* FAQ
* About
* About us
* Get in touch
* Insights
* Login
* Let's start!
*
LOGIN
Welcome back to Company Spotter!
Email Address
Password Forgot password?
Login
No account yet? Register
CREATE AN ACCOUNT
Register as a user and get 50 credits free every month!
First name
Last name
Email Address
Country
AFALDZASADAOAIAQAGARAMAWAUATAZBSBHBDBBBYBEBZBJBMBTBOBABWBRIOVGBNBGBFBIKHCMCACVKYCFTDCLCNCXCCCOKMCKCRHRCUCWCYCZCDDKDJDMDOTLECEGSVGQEREEETFKFOFJFIFRPFGAGMGEDEGHGIGRGLGDGUGTGGGNGWGYHTHNHKHUISINIDIRIQIEIMILITCIJMJPJEJOKZKEKIXKKWKGLALVLBLSLRLYLILTLUMOMKMGMWMYMVMLMTMHMRMUYTMXFMMDMCMNMEMSMAMZMMNANRNPNLANNCNZNINENGNUKPMPNOOMPKPWPSPAPGPYPEPHPNPLPTPRQACGRERORURWBLSHKNLCMFPMVCWSSMSTSASNRSSCSLSGSXSKSISBSOZAKRSSESLKSDSRSJSZSECHSYTWTJTZTHTGTKTOTTTNTRTMTCTVVIUGUAAEGBUSUYUZVUVAVEVNWFEHYEZMZW
Password
Repeat password
Yes, I have read and I accept the Terms of Use.
Yes, I have read and I accept the Privacy Statements.
Register
Already have an account? Log in
FIND, EXPORT & CONNECT
Find company information from businesses all over the world
SEARCH, FIND & CONNECT
Find company information from businesses all over the world
Search
Try me!
Give me an example!
CompanySpotter
You are searching with a negation option. Read more.
A SELECTION OF OUR SERVICES
Creating leadlists B2B search Website analysis
HOW IT WORKS
Search and select on
your own terms
We have done our best to provide you with as many tools as possible to best
discover and select your business target group. Be smart, creative, effective
and successful!
Check it out
COMPANY PROFILES
See what's happening
Discover and analyze different companies and their websites through
comprehensive company profiles. See what your target group and your competitors
are doing.
Check it out
CREATE A LEAD LIST
Ready, set, go!
Are you and your team ready to start targeting the very best leads? Simply
create your ideal lead list yourself and get started today.
Check it out
To view this video please enable JavaScript, and consider upgrading to a web
browser that supports HTML5 video
Video Player is loading.
Play Video
Play
Mute
Current Time 0:00
/
Duration 0:37
Loaded: 42.03%
0:00
Stream Type LIVE
Seek to live, currently behind liveLIVE
Remaining Time -0:37
1x
Playback Rate
Chapters
* Chapters
Descriptions
* descriptions off, selected
Captions
* captions settings, opens captions settings dialog
* captions off, selected
Audio Track
Picture-in-PictureFullscreen
This is a modal window.
Beginning of dialog window. Escape will cancel and close the window.
TextColorWhiteBlackRedGreenBlueYellowMagentaCyanTransparencyOpaqueSemi-TransparentBackgroundColorBlackWhiteRedGreenBlueYellowMagentaCyanTransparencyOpaqueSemi-TransparentTransparentWindowColorBlackWhiteRedGreenBlueYellowMagentaCyanTransparencyTransparentSemi-TransparentOpaque
Font Size50%75%100%125%150%175%200%300%400%Text Edge
StyleNoneRaisedDepressedUniformDropshadowFont FamilyProportional
Sans-SerifMonospace Sans-SerifProportional SerifMonospace SerifCasualScriptSmall
Caps
Reset restore all settings to the default valuesDone
Close Modal Dialog
End of dialog window.
A selection of our services
Creating leadlists Keyword search Find technologies
HOW IT WORKS
Follow our steps,
we will help you
No more time-consuming search work to then copy paste company info from google
into excel. No more filtering of outdated company data.
To view this video please enable JavaScript, and consider upgrading to a web
browser that supports HTML5 video
Video Player is loading.
Play Video
Play
Mute
Current Time 0:00
/
Duration 0:37
Loaded: 42.03%
0:00
Stream Type LIVE
Seek to live, currently behind liveLIVE
Remaining Time -0:37
1x
Playback Rate
Chapters
* Chapters
Descriptions
* descriptions off, selected
Captions
* captions settings, opens captions settings dialog
* captions off, selected
Audio Track
Picture-in-PictureFullscreen
This is a modal window.
Beginning of dialog window. Escape will cancel and close the window.
TextColorWhiteBlackRedGreenBlueYellowMagentaCyanTransparencyOpaqueSemi-TransparentBackgroundColorBlackWhiteRedGreenBlueYellowMagentaCyanTransparencyOpaqueSemi-TransparentTransparentWindowColorBlackWhiteRedGreenBlueYellowMagentaCyanTransparencyTransparentSemi-TransparentOpaque
Font Size50%75%100%125%150%175%200%300%400%Text Edge
StyleNoneRaisedDepressedUniformDropshadowFont FamilyProportional
Sans-SerifMonospace Sans-SerifProportional SerifMonospace SerifCasualScriptSmall
Caps
Reset restore all settings to the default valuesDone
Close Modal Dialog
End of dialog window.
WEBSITE ANALYSIS
Find out how websites are built and what software is used.
LEAD GENERATION
Find your ideal business target group through various intelligent and creative
search methods.
MARKET RESEARCH
Conduct your own research on industries, technologies, regions and more to
better understand your market.
COMPETITOR ANALYSIS
Find out who is using competitors' software and Web technologies and use that to
your own advantage.
DATA ENRICHMENT
Clean up your own database and enrich it with current and relevant data.
LEAD LISTS
Easily create complete lists of business leads, including contact information
and links to social media profiles.
MORE SERVICES
WEBSITE SEARCH
Find organizations and websites based on the domain name or a specific word in
the domain name. If you search on the word "hairdresser," you will see all
websites where this word appears in the domain name. Perfect for discovering new
audiences in a creative way.
Search domains
KEYWORD SEARCH
Search organizations and websites based on one or more words present on the
website. If you search on the word "cleaning," you will see all websites where
this word is found. Combine it with a word such as "office" to further refine
your search. Use your own creativity to discover new audiences.
Search keywords
INDUSTRY SEARCH
Find businesses based on their activities. Are you looking for a Chinese
restaurant or just a greengrocer? Maybe a limo service or a landscaper? You can
easily select one or more industries. An ideal way to discover businesses
working within the same industry!
Search industry
TECHNOLOGY SEARCH
Search organizations and websites based on specific technology or software on
the Web site. You can search either by the name of the software or by the entire
category. For example, consider the category "eCommerce" to find web shops or
use "Zendesk" if you want to very specifically find users of Zendesk. What
detailed information will you use to discover your target audience?
Search technology
COMPANY SEARCH
Search organizations and websites of organizations based on the company name or
a specific word in the company name. If you search for the word 'cab', you will
see all websites where this word appears in the company name. Perfect for
finding that one company, or a clever way to spot similar companies.
Search companyname
LOCATION SEARCH
Search for organizations based on their location. Search on the word "Amsterdam"
and you will see all registered businesses located in Amsterdam. A convenient
way to discover what businesses can be located locally and regionally.
Search location
EXPERT SEARCH
Ready to use all the tools at once? Bring it on! Use and combine all possible
search functions simultaneously to make razor-sharp selections. Start typing and
use the suggestions to build your own search. When you're done, hit search and
marvel at your own search skills.
Search like an expert
COMPANYSPOTTER
To view this video please enable JavaScript, and consider upgrading to a web
browser that supports HTML5 video
Video Player is loading.
Play Video
Play
Mute
Current Time 0:00
/
Duration -:-
Loaded: 0%
0:00
Stream Type LIVE
Seek to live, currently behind liveLIVE
Remaining Time --:-
1x
Playback Rate
Chapters
* Chapters
Descriptions
* descriptions off, selected
Captions
* captions settings, opens captions settings dialog
* captions off, selected
Audio Track
Picture-in-PictureFullscreen
This is a modal window.
Beginning of dialog window. Escape will cancel and close the window.
TextColorWhiteBlackRedGreenBlueYellowMagentaCyanTransparencyOpaqueSemi-TransparentBackgroundColorBlackWhiteRedGreenBlueYellowMagentaCyanTransparencyOpaqueSemi-TransparentTransparentWindowColorBlackWhiteRedGreenBlueYellowMagentaCyanTransparencyTransparentSemi-TransparentOpaque
Font Size50%75%100%125%150%175%200%300%400%Text Edge
StyleNoneRaisedDepressedUniformDropshadowFont FamilyProportional
Sans-SerifMonospace Sans-SerifProportional SerifMonospace SerifCasualScriptSmall
Caps
Reset restore all settings to the default valuesDone
Close Modal Dialog
End of dialog window.
HOW COMPANYSPOTTER'S SERVICES ARE USED
Simple and fast!
The simplicity, the speed and the idea that this is a search engine specifically
for businesses. I have been amazed at how incredibly simple it is. That I can
eventually cram the results of my searches all directly into an Excel file as
leads is ideal for me. So yes, great!
Amazing tools
Time is precious. Time can be spent and wasted in many different ways. You guys
have just introduced a great new way of working, and it's just right. I am
already very happy with the current tooling and very much looking forward to
your further developments.
All Microsoft 365 users, wow!
The speed and ease of use. I search and immediately get a list of companies.
Yesterday I asked my colleague to search for specific companies in the area that
use Office 365. Within seconds he typed in the search and I got 4,703 relevant
companies, including contact information. Wow!
Italian restaurants
I was recently looking for a list of all Italian restaurants in the Netherlands
in connection to a newly developed organic product. In this case, CompanySpotter
worked perfectly. I had never been able to find these businesses before through
traditional solutions ( yes restaurants, but not specifically Italian). And
trying to find everything through Google, and then spending hours manually
copying-and-pasting to build a lead list, isn't doable either.
Fun and freedom
I am enjoying CompanySpotter immensely. For me, it's the freedom of search that
CompanySpotter gives me. CompanySpotter challenges me to use my creativity and
get to work with all the digital tools. Thank you!
Webshops found
We help companies optimize their webshop and our target group consists of
companies that have an active webshop, but are using (somewhat) outdated
software. How cool is it then to just be able to search for specific software,
including version numbers. For us, this was perfect!
Better leads for call centers
In the past, I have had problems with call centers used by us to follow up on
leads. The reason was that the leads were too generic. As a result, results fell
behind and the agents became demotivated. Now that we use CompanySpotter, almost
all calls are relevant, results have improved significantly and the agents are a
lot happier with our project.
Cheap B2B data
For me, the reason to start working with CompanySpotter was mainly the result of
frustration. I was disappointed in the huge costs of some B2B data providers,
where it almost seemed like a revenue model to make things as difficult as
possible for me, only to charge a lot of money to be assisted. Now I do it
(without being a data expert) all by myself and save time and a lot of money.
CHECK OUT OUR PRICING
Monthly billing Yearly billing
Free
€ 0 / MONTH
--------------------------------------------------------------------------------
1 user
50 free credits every month
Credits are valid for 30 days
No creditcard required
More info Get started
Small
€ 69 / MONTH *
--------------------------------------------------------------------------------
5.000 credits every month
1 user
50 free credits every month
Use bought credits to create leadlists
Credits are valid for 60 days
More info Buy now
Medium Popular
€ 124 / MONTH *
--------------------------------------------------------------------------------
25.000 credits every month
1 user
50 free credits every month
Use bought credits to create leadlists
Credits are valid for 60 days
More info Buy now
Large
€ 264 / MONTH *
--------------------------------------------------------------------------------
100.000 credits every month
3 users
50 free credits every month
Use bought credits to create leadlists
Credits are valid for 60 days
More info Buy now
Extra large
€ 349 / MONTH *
--------------------------------------------------------------------------------
250.000 credits every month
10 users
50 free credits every month
Use bought credits to create leadlists
Credits are valid for 60 days
More info Buy now
Custom
GET IN TOUCH!
--------------------------------------------------------------------------------
>250.000 credits every month
>10 users
50 free credits every month
Use bought credits to create leadlists
Credits are valid for 60 days
More info Contact
* We provide our services exclusively to businesses. All prices are therefore
without VAT.
IT'S EASY TO GET STARTED
And you get 50 free credits. Two things everybody loves!
Get started
Services
Website checker
Keyword search
Industry search
Technology search
Company search
Location search
Expert search
Lead list
Pricing
Plans
Free subscription
Small subscription
Medium subscription
Large subscription
Extra Large subscription
Custom subscription
Credit Bundle
Resources
Industries
Technologies
Database
FAQ
Legal
Privacy Centre
Terms of service
Privacy Statement
Cookie Statement
Disclaimer
Anti Spam policy
Remove my data
About
About us
Get in touch
Buyer Protection
Privacy policy |
We use cookies
We may place these for analysis of our visitor data, to improve our website,
show personalised content and to give you a great website experience. For more
information about the cookies we use open the settings.
Accept all
Deny
No, adjust