www.dodoskin.com
Open in
urlscan Pro
2620:127:f00f:e::
Public Scan
Submitted URL: https://dodoskin.smsb.co/8XnlNt
Effective URL: https://www.dodoskin.com/?utm_source=flow&utm_medium=SMS&utm_campaign=welcome_flow_1501537&wtbap=NTczMjE4Mzc0NTA4
Submission: On June 02 via manual from CO — Scanned from DE
Effective URL: https://www.dodoskin.com/?utm_source=flow&utm_medium=SMS&utm_campaign=welcome_flow_1501537&wtbap=NTczMjE4Mzc0NTA4
Submission: On June 02 via manual from CO — Scanned from DE
Form analysis
41 forms found in the DOMPOST /localization
<form action="/localization" method="POST"><input name="_method" type="hidden" value="PUT"><input name="source" type="hidden" value="geolocation_recommendation"><input name="return_to" type="hidden"
value="/?utm_source=flow&utm_medium=SMS&utm_campaign=welcome_flow_1501537&wtbap=NTczMjE4Mzc0NTA4"><input name="country_code" type="hidden" value="DE"><input name="locale_code" type="hidden" value="de"><button
class="recommendation-modal__close-button" type="submit"><svg aria-label="Dismiss" viewBox="0 0 20 20" xmlns="http://www.w3.org/2000/svg" style="height: 1em; width: 1em;">
<path d="M11.414 10l6.293-6.293a.999.999 0 1 0-1.414-1.414L10 8.586 3.707 2.293a.999.999 0 1 0-1.414 1.414L8.586 10l-6.293 6.293a.999.999 0 1 0 1.414 1.414L10 11.414l6.293 6.293a.997.997 0 0 0 1.414 0 .999.999 0 0 0 0-1.414L11.414 10z"
fill="#333333"></path>
</svg></button></form>
POST /localization
<form action="/localization" method="POST" class="recommendation-modal__form"><input name="_method" type="hidden" value="PUT"><input name="source" type="hidden" value="geolocation_recommendation"><input name="return_to" type="hidden"
value="/?utm_source=flow&utm_medium=SMS&utm_campaign=welcome_flow_1501537&wtbap=NTczMjE4Mzc0NTA4"><input name="country_code" type="hidden" value="DE"><input name="locale_code" type="hidden" value="de"><button
class="recommendation-modal__button" type="submit" style="background-color: rgb(0, 0, 0); color: rgb(255, 255, 255);">Fortfahren</button></form>
POST /cart
<form action="/cart" method="post" novalidate="" data-cart-form="">
<div class="cart__widget__wrapper" data-collapsible-single="">
<div class="cart__widget" data-cart-widget="">
<button class="cart__widget__title" type="button" data-collapsible-trigger="" aria-expanded="false" aria-controls="notes">Add order notes<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-toggle-plus"
viewBox="0 0 192 192">
<path d="M30 96h132M96 30v132" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
</svg><svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-toggle-minus" viewBox="0 0 192 192">
<path d="M30 96h132" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
</svg></button>
<div id="notes" aria-expanded="false" data-collapsible-container="">
<div class="cart__widget__content" data-collapsible-content="">
<label for="note">Special instructions for seller</label>
<textarea id="note" name="note" class="cart__field cart__field--textarea" aria-label="Special instructions for seller"></textarea>
</div>
</div>
</div>
<div class="cart__widget" data-cart-widget="">
<button class="cart__widget__title" type="button" data-collapsible-trigger="" aria-expanded="false" aria-controls="gift-notes">Is this a gift? Add a note.<svg aria-hidden="true" focusable="false" role="presentation"
class="icon icon-toggle-plus" viewBox="0 0 192 192">
<path d="M30 96h132M96 30v132" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
</svg><svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-toggle-minus" viewBox="0 0 192 192">
<path d="M30 96h132" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
</svg></button>
<div id="gift-notes" aria-expanded="false" data-collapsible-container="">
<div class="cart__widget__content" data-collapsible-content=""><label for="gift-note">Add a note for recipient</label>
<textarea id="gift-note" name="attributes[Gift note]" class="cart__field cart__field--textarea" aria-label="Add a note for recipient">
</textarea>
</div>
</div>
</div>
</div>
<div class="cart__foot-inner">
<div data-cart-price-holder="">
<div class="cart__total hidden">
<span>Items</span>
<span data-cart-total="0">Free</span>
</div>
<div class="cart__discounts hidden"></div>
</div>
<div class="cart__buttons-wrapper">
<p class="cart__terms cart__errors__content" data-terms-error-message=""></p>
<div class="cart__buttons" data-cart-checkout-buttons="">
<fieldset class="cart__buttons__fieldset" data-cart-checkout-button="">
<div class="discount_code_box" style="display: none;">
<div class="hulkapps_discount_hide">
<input placeholder="Discount code" class="hulkapps_discount_code" autocomplete="off" aria-required="true" size="30" type="text" name="checkout_discount">
<button type="button" class="hulkapps_discount_button btn btn--primary button">Apply</button>
</div>
</div>
<button type="submit" name="checkout" class="cart__checkout btn">Checkout<span data-hulkapps-cart-total="" class="cart__total__money" data-cart-total-price="">Free</span>
</button>
</fieldset>
</div>
</div>
<p class="cart__text" style="margin-bottom: -5px">Volume discounts will be applied during the final checkout.</p>
<p class="cart__text">Shipping & taxes calculated at checkout</p>
</div>
</form>
GET /search
<form class="search-form" action="/search" method="get" role="search" data-search-form="">
<input name="options[prefix]" type="hidden" value="last" aria-label="options[prefix]">
<div class="search-form__inner" data-search-form-inner="">
<div class="search-form__input-holder">
<label for="searchInput-desktop-compress" class="search-form__label">
<span class="visually-hidden">Search for products on our site</span><svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-search" viewBox="0 0 192 192">
<path d="M87 150c34.794 0 63-28.206 63-63s-28.206-63-63-63-63 28.206-63 63 28.206 63 63 63ZM131.55 131.55 168 168" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
</svg></label>
<input type="search" id="searchInput-desktop-compress" class="search-form__input" name="q" value="" aria-label="Search our store" role="combobox" aria-expanded="false" aria-owns="searchResults-desktop-compress"
aria-controls="searchResults-desktop-compress" aria-haspopup="listbox" aria-autocomplete="list" autocorrect="off" autocomplete="off" autocapitalize="off" spellcheck="false">
<button class="search-form__submit visually-hidden" type="submit" tabindex="-1" aria-label="Search"><svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-search" viewBox="0 0 192 192">
<path d="M87 150c34.794 0 63-28.206 63-63s-28.206-63-63-63-63 28.206-63 63 28.206 63 63 63ZM131.55 131.55 168 168" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
</svg></button>
<button type="button" class="search-popdown__close" title="Close" data-popdown-close=""><svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-close" viewBox="0 0 192 192">
<path d="M150 42 42 150M150 150 42 42" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
</svg></button>
</div>
</div>
<div id="searchResults-desktop-compress" class="search-popdown__results">
<div class="predictive-search" data-predictive-search-results="" data-scroll-lock-scrollable="">
<div class="predictive-search__loading-state">
<div class="predictive-search__loader loader loader--line">
<div class="loader-indeterminate"></div>
</div>
</div>
</div>
<span class="predictive-search-status visually-hidden" role="status" aria-hidden="true" data-predictive-search-status=""></span>
</div>
</form>
GET /search
<form class="search-form" action="/search" method="get" role="search" data-search-form="">
<input name="options[prefix]" type="hidden" value="last" aria-label="options[prefix]">
<div class="search-form__inner" data-search-form-inner="">
<div class="search-form__input-holder">
<label for="searchInput-desktop" class="search-form__label">
<span class="visually-hidden">Search for products on our site</span><svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-search" viewBox="0 0 192 192">
<path d="M87 150c34.794 0 63-28.206 63-63s-28.206-63-63-63-63 28.206-63 63 28.206 63 63 63ZM131.55 131.55 168 168" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
</svg></label>
<input type="search" id="searchInput-desktop" class="search-form__input" name="q" value="" aria-label="Search our store" role="combobox" aria-expanded="false" aria-owns="searchResults-desktop" aria-controls="searchResults-desktop"
aria-haspopup="listbox" aria-autocomplete="list" autocorrect="off" autocomplete="off" autocapitalize="off" spellcheck="false">
<button class="search-form__submit visually-hidden" type="submit" tabindex="-1" aria-label="Search"><svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-search" viewBox="0 0 192 192">
<path d="M87 150c34.794 0 63-28.206 63-63s-28.206-63-63-63-63 28.206-63 63 28.206 63 63 63ZM131.55 131.55 168 168" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
</svg></button>
<button type="button" class="search-popdown__close" title="Close" data-popdown-close=""><svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-close" viewBox="0 0 192 192">
<path d="M150 42 42 150M150 150 42 42" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
</svg></button>
</div>
</div>
<div id="searchResults-desktop" class="search-popdown__results">
<div class="predictive-search" data-predictive-search-results="" data-scroll-lock-scrollable="">
<div class="predictive-search__loading-state">
<div class="predictive-search__loader loader loader--line">
<div class="loader-indeterminate"></div>
</div>
</div>
</div>
<span class="predictive-search-status visually-hidden" role="status" aria-hidden="true" data-predictive-search-status=""></span>
</div>
</form>
GET /search
<form class="search-form" action="/search" method="get" role="search" data-search-form="">
<input name="options[prefix]" type="hidden" value="last" aria-label="options[prefix]">
<div class="search-form__inner" data-search-form-inner="">
<div class="search-form__input-holder">
<label for="searchInput-mobile" class="search-form__label">
<span class="visually-hidden">Search for products on our site</span><svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-search" viewBox="0 0 192 192">
<path d="M87 150c34.794 0 63-28.206 63-63s-28.206-63-63-63-63 28.206-63 63 28.206 63 63 63ZM131.55 131.55 168 168" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
</svg></label>
<input type="search" id="searchInput-mobile" class="search-form__input" name="q" value="" aria-label="Search our store" role="combobox" aria-expanded="false" aria-owns="searchResults-mobile" aria-controls="searchResults-mobile"
aria-haspopup="listbox" aria-autocomplete="list" autocorrect="off" autocomplete="off" autocapitalize="off" spellcheck="false">
<button class="search-form__submit visually-hidden" type="submit" tabindex="-1" aria-label="Search"><svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-search" viewBox="0 0 192 192">
<path d="M87 150c34.794 0 63-28.206 63-63s-28.206-63-63-63-63 28.206-63 63 28.206 63 63 63ZM131.55 131.55 168 168" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
</svg></button>
<button type="button" class="search-popdown__close" title="Close" data-popdown-close=""><svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-close" viewBox="0 0 192 192">
<path d="M150 42 42 150M150 150 42 42" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
</svg></button>
</div>
</div>
<div id="searchResults-mobile" class="search-popdown__results">
<div class="predictive-search" data-predictive-search-results="" data-scroll-lock-scrollable="">
<div class="predictive-search__loading-state">
<div class="predictive-search__loader loader loader--line">
<div class="loader-indeterminate"></div>
</div>
</div>
</div>
<span class="predictive-search-status visually-hidden" role="status" aria-hidden="true" data-predictive-search-status=""></span>
</div>
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414-8113310105756" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43784322810012" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="8113310105756" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414-8113320394908" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43784356528284" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="8113320394908" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414-8113314234524" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43784334966940" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="8113314234524" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414-8113317314716" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43784345780380" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="8113317314716" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414-8113052516508" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43783282229404" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="8113052516508" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414-8117822062748" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43791556739228" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="8117822062748" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414-7552688947356" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="42331545174172" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="0">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7552688947356" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414-7557017108636" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="42340668309660" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="0">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7557017108636" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414-7885741818012" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43156865745052" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="0">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7885741818012" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414-7886467825820" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43162380075164" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="0">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7886467825820" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414-6044675834012" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="40291792650396" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="6044675834012" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414-6044823617692" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="40291780034716" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="6044823617692" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414-6044827254940" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="40291785244828" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="6044827254940" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414-6044827648156" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="40291836199068" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="6044827648156" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414-6044827910300" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="40291798548636" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="6044827910300" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414-6044828369052" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="40291776463004" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="6044828369052" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414-6044828401820" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="40291809689756" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="6044828401820" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414-6044828696732" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="40291849797788" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="6044828696732" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__6f10f80a-90fa-445a-aafd-0567d479c414" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f-8118869655708" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43794889212060" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="0">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="8118869655708" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f-8118356705436" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43793288298652" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="8118356705436" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f-8118147612828" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43792640639132" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="8118147612828" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f-8117882192028" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43791754920092" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="8117882192028" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f-8111703064732" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43781213913244" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="8111703064732" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f-8109631701148" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43774499553436" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="8109631701148" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f-8109501677724" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43773764305052" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="8109501677724" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f-8109443940508" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="43773500719260" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="8109443940508" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4bd26e95-9219-44cc-8958-0ee61159d60f" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4cf35844-daa9-481f-b090-8c1bf37ee05d-7838190141596" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="42986886004892" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="0">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7838190141596" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4cf35844-daa9-481f-b090-8c1bf37ee05d" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4cf35844-daa9-481f-b090-8c1bf37ee05d-7448181571740" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="42041198543004" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="0">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7448181571740" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4cf35844-daa9-481f-b090-8c1bf37ee05d" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4cf35844-daa9-481f-b090-8c1bf37ee05d-7531769692316" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="42270425186460" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="7531769692316" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4cf35844-daa9-481f-b090-8c1bf37ee05d" aria-label="section-id">
</form>
POST /cart/add
<form method="post" action="/cart/add" id="template--16191090884764__4cf35844-daa9-481f-b090-8c1bf37ee05d-6044550463644" accept-charset="UTF-8" class="quick__form" enctype="multipart/form-data" data-product-form="" data-quickbuy-form=""><input
type="hidden" name="form_type" value="product" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="quantity" value="1" aria-label="quantity">
<input type="hidden" name="id" value="40528202039452" aria-label="id">
<button type="submit" name="add" class="btn--quick rounded" data-add-to-cart="" data-atc-trigger="" tabindex="-1">
<span class="btn__inner">
<svg aria-hidden="true" focusable="false" role="presentation" class="icon icon-shopping-bag" viewBox="0 0 192 192">
<path d="M156.6 162H35.4a6.075 6.075 0 0 1-6-5.325l-10.65-96A6 6 0 0 1 24.675 54h142.65a6.001 6.001 0 0 1 5.925 6.675l-10.65 96a6.076 6.076 0 0 1-6 5.325v0Z" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M66 78V54a30 30 0 1 1 60 0v24" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
<circle class="cart-indicator" cx="96" cy="108" r="15"></circle>
</svg>
<span class="btn__text">Quick Buy</span>
<span class="btn__loader">
<svg height="18" width="18" class="svg-loader">
<circle r="7" cx="9" cy="9"></circle>
<circle stroke-dasharray="87.96459430051421 87.96459430051421" r="7" cx="9" cy="9"></circle>
</svg>
</span>
</span>
</button>
<div class="product-grid-item__error" role="alert" data-cart-errors-container=""></div><input type="hidden" name="product-id" value="6044550463644" aria-label="product-id"><input type="hidden" name="section-id"
value="template--16191090884764__4cf35844-daa9-481f-b090-8c1bf37ee05d" aria-label="section-id">
</form>
POST /contact#NewsletterForm--template--16191090884764__f91dba82-a9f9-4019-9002-a16133ec5c98
<form method="post" action="/contact#NewsletterForm--template--16191090884764__f91dba82-a9f9-4019-9002-a16133ec5c98" id="NewsletterForm--template--16191090884764__f91dba82-a9f9-4019-9002-a16133ec5c98" accept-charset="UTF-8" class="newsletter-form"
data-newsletter-form=""><input type="hidden" name="form_type" value="customer" aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="contact[accepts_marketing]" value="true"
aria-label="contact[accepts_marketing]">
<div class="input-group">
<div class="input-group__fields input-group__fields--name">
<div class="input-group__item input-group__item--name">
<input type="text" id="Name--template--16191090884764__f91dba82-a9f9-4019-9002-a16133ec5c98" class="input-group__field input-group__field--name" value="" placeholder="Your name" name="contact[first_name]" autocorrect="off"
autocapitalize="off" aria-label="Your name">
</div>
<div class="input-group__item input-group__item--email">
<input type="email" id="Email--template--16191090884764__f91dba82-a9f9-4019-9002-a16133ec5c98" class="input-group__field input-group__field--email" value="" placeholder="Your email" name="contact[email]" autocorrect="off" autocapitalize="off"
aria-label="Your email">
</div>
</div>
<div class="input-group__item input-group__item--btn input-group__item--btn-width">
<button type="submit" name="subscribe" id="SubscribeSubmit--template--16191090884764__f91dba82-a9f9-4019-9002-a16133ec5c98" class="input-group__btn btn">Sign up</button>
</div>
</div>
<div class="errors">Email is invalid or already taken.</div>
</form>
POST /contact#NewsletterForm--footer-block-3
<form method="post" action="/contact#NewsletterForm--footer-block-3" id="NewsletterForm--footer-block-3" accept-charset="UTF-8" class="newsletter-form" data-newsletter-form=""><input type="hidden" name="form_type" value="customer"
aria-label="form_type"><input type="hidden" name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="contact[accepts_marketing]" value="true" aria-label="contact[accepts_marketing]">
<div class="input-group input-group--inline">
<div class="input-group__fields">
<div class="input-group__item input-group__item--email">
<input type="email" id="Email--footer-block-3" class="input-group__field input-group__field--email" value="" placeholder="Your email" name="contact[email]" autocorrect="off" autocapitalize="off" aria-label="Your email">
</div>
</div>
<div class="input-group__item input-group__item--btn">
<button type="submit" name="subscribe" id="SubscribeSubmit--footer-block-3" class="input-group__btn input-group__btn--icon"><span class="visually-hidden">Subscribe to Our Newsletter</span><svg aria-hidden="true" focusable="false"
role="presentation" class="icon icon-select" viewBox="0 0 192 192">
<path d="m72 36 60 60-60 60" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
</svg></button>
</div>
</div>
<div class="errors">Email is invalid or already taken.</div>
</form>
POST /localization
<form method="post" action="/localization" id="LocalizationForm" accept-charset="UTF-8" class="footer__select-popout" enctype="multipart/form-data"><input type="hidden" name="form_type" value="localization" aria-label="form_type"><input type="hidden"
name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="_method" value="put" aria-label="_method"><input type="hidden" name="return_to"
value="/?utm_source=flow&utm_medium=SMS&utm_campaign=welcome_flow_1501537&wtbap=NTczMjE4Mzc0NTA4" aria-label="return_to">
<div>
<h2 class="visually-hidden" id="lang-heading"> Language </h2>
<div class="select-popout" data-popout="">
<button type="button" class="select-popout__toggle" aria-expanded="false" aria-controls="lang-list" aria-describedby="lang-heading" data-popout-toggle=""> English <svg aria-hidden="true" focusable="false" role="presentation"
class="icon icon-select" viewBox="0 0 192 192">
<path d="m72 36 60 60-60 60" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
</svg></button>
<div id="lang-list" class="select-popout__list" data-popout-list="">
<ul class="select-popout__list__scroll">
<li class="select-popout__item select-popout__item--current">
<a class="select-popout__option" href="#" lang="" data-value="en" data-popout-option="">
<span>English</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" lang="" data-value="fr" data-popout-option="">
<span>français</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" lang="" data-value="ja" data-popout-option="">
<span>日本語</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" lang="" data-value="es" data-popout-option="">
<span>Español</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" lang="" data-value="ar" data-popout-option="">
<span>العربية</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" lang="" data-value="de" data-popout-option="">
<span>Deutsch</span>
</a>
</li>
</ul>
</div>
<input type="hidden" name="locale_code" id="LocaleSelector" value="en" data-popout-input="" aria-label="locale_code">
</div>
</div>
<div>
<h2 class="visually-hidden" id="currency-heading"> Currency </h2>
<div class="select-popout" data-popout=""><button type="button" class="select-popout__toggle" aria-expanded="false" aria-controls="currency-list" aria-describedby="currency-heading" data-popout-toggle=""> USD $<svg aria-hidden="true"
focusable="false" role="presentation" class="icon icon-select" viewBox="0 0 192 192">
<path d="m72 36 60 60-60 60" stroke="currentColor" stroke-linecap="round" stroke-linejoin="round"></path>
</svg></button>
<div id="currency-list" class="select-popout__list" data-popout-list="">
<ul class="select-popout__list__scroll">
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="AED" data-popout-option="">
<span>AED د.إ</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="AFN" data-popout-option="">
<span>AFN ؋</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="ALL" data-popout-option="">
<span>ALL L</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="AMD" data-popout-option="">
<span>AMD դր.</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="ANG" data-popout-option="">
<span>ANG ƒ</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="ARS" data-popout-option="">
<span>ARS $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="AUD" data-popout-option="">
<span>AUD $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="AWG" data-popout-option="">
<span>AWG ƒ</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="AZN" data-popout-option="">
<span>AZN ₼</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="BAM" data-popout-option="">
<span>BAM КМ</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="BBD" data-popout-option="">
<span>BBD $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="BDT" data-popout-option="">
<span>BDT ৳</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="BGN" data-popout-option="">
<span>BGN лв.</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="BIF" data-popout-option="">
<span>BIF Fr</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="BND" data-popout-option="">
<span>BND $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="BOB" data-popout-option="">
<span>BOB Bs.</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="BRL" data-popout-option="">
<span>BRL R$</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="BSD" data-popout-option="">
<span>BSD $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="BWP" data-popout-option="">
<span>BWP P</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="BZD" data-popout-option="">
<span>BZD $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="CAD" data-popout-option="">
<span>CAD $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="CDF" data-popout-option="">
<span>CDF Fr</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="CHF" data-popout-option="">
<span>CHF CHF</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="CNY" data-popout-option="">
<span>CNY ¥</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="CRC" data-popout-option="">
<span>CRC ₡</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="CVE" data-popout-option="">
<span>CVE $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="CZK" data-popout-option="">
<span>CZK Kč</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="DJF" data-popout-option="">
<span>DJF Fdj</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="DKK" data-popout-option="">
<span>DKK kr.</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="DOP" data-popout-option="">
<span>DOP $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="DZD" data-popout-option="">
<span>DZD د.ج</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="EGP" data-popout-option="">
<span>EGP ج.م</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="ETB" data-popout-option="">
<span>ETB Br</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="EUR" data-popout-option="">
<span>EUR €</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="FJD" data-popout-option="">
<span>FJD $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="FKP" data-popout-option="">
<span>FKP £</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="GBP" data-popout-option="">
<span>GBP £</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="GMD" data-popout-option="">
<span>GMD D</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="GNF" data-popout-option="">
<span>GNF Fr</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="GTQ" data-popout-option="">
<span>GTQ Q</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="GYD" data-popout-option="">
<span>GYD $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="HKD" data-popout-option="">
<span>HKD $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="HNL" data-popout-option="">
<span>HNL L</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="HUF" data-popout-option="">
<span>HUF Ft</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="IDR" data-popout-option="">
<span>IDR Rp</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="ILS" data-popout-option="">
<span>ILS ₪</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="INR" data-popout-option="">
<span>INR ₹</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="ISK" data-popout-option="">
<span>ISK kr</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="JMD" data-popout-option="">
<span>JMD $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="JPY" data-popout-option="">
<span>JPY ¥</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="KES" data-popout-option="">
<span>KES KSh</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="KGS" data-popout-option="">
<span>KGS som</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="KHR" data-popout-option="">
<span>KHR ៛</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="KMF" data-popout-option="">
<span>KMF Fr</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="KYD" data-popout-option="">
<span>KYD $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="KZT" data-popout-option="">
<span>KZT 〒</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="LAK" data-popout-option="">
<span>LAK ₭</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="LBP" data-popout-option="">
<span>LBP ل.ل</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="LKR" data-popout-option="">
<span>LKR ₨</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="MAD" data-popout-option="">
<span>MAD د.م.</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="MDL" data-popout-option="">
<span>MDL L</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="MKD" data-popout-option="">
<span>MKD ден</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="MNT" data-popout-option="">
<span>MNT ₮</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="MOP" data-popout-option="">
<span>MOP P</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="MUR" data-popout-option="">
<span>MUR ₨</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="MVR" data-popout-option="">
<span>MVR MVR</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="MWK" data-popout-option="">
<span>MWK MK</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="MXN" data-popout-option="">
<span>MXN $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="MYR" data-popout-option="">
<span>MYR RM</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="NGN" data-popout-option="">
<span>NGN ₦</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="NIO" data-popout-option="">
<span>NIO C$</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="NPR" data-popout-option="">
<span>NPR ₨</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="NZD" data-popout-option="">
<span>NZD $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="PEN" data-popout-option="">
<span>PEN S/.</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="PGK" data-popout-option="">
<span>PGK K</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="PHP" data-popout-option="">
<span>PHP ₱</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="PKR" data-popout-option="">
<span>PKR ₨</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="PLN" data-popout-option="">
<span>PLN zł</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="PYG" data-popout-option="">
<span>PYG ₲</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="QAR" data-popout-option="">
<span>QAR ر.ق</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="RON" data-popout-option="">
<span>RON Lei</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="RSD" data-popout-option="">
<span>RSD РСД</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="RWF" data-popout-option="">
<span>RWF FRw</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="SAR" data-popout-option="">
<span>SAR ر.س</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="SBD" data-popout-option="">
<span>SBD $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="SEK" data-popout-option="">
<span>SEK kr</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="SGD" data-popout-option="">
<span>SGD $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="SHP" data-popout-option="">
<span>SHP £</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="SLL" data-popout-option="">
<span>SLL Le</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="STD" data-popout-option="">
<span>STD Db</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="THB" data-popout-option="">
<span>THB ฿</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="TJS" data-popout-option="">
<span>TJS ЅМ</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="TOP" data-popout-option="">
<span>TOP T$</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="TTD" data-popout-option="">
<span>TTD $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="TWD" data-popout-option="">
<span>TWD $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="TZS" data-popout-option="">
<span>TZS Sh</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="UAH" data-popout-option="">
<span>UAH ₴</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="UGX" data-popout-option="">
<span>UGX USh</span>
</a>
</li>
<li class="select-popout__item select-popout__item--current">
<a class="select-popout__option" href="#" aria-current="true" data-value="USD" data-popout-option="">
<span>USD $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="UYU" data-popout-option="">
<span>UYU $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="UZS" data-popout-option="">
<span>UZS </span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="VND" data-popout-option="">
<span>VND ₫</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="VUV" data-popout-option="">
<span>VUV Vt</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="WST" data-popout-option="">
<span>WST T</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="XAF" data-popout-option="">
<span>XAF Fr</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="XCD" data-popout-option="">
<span>XCD $</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="XOF" data-popout-option="">
<span>XOF Fr</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="XPF" data-popout-option="">
<span>XPF Fr</span>
</a>
</li>
<li class="select-popout__item">
<a class="select-popout__option" href="#" data-value="YER" data-popout-option="">
<span>YER ﷼</span>
</a>
</li>
</ul>
</div>
<input type="hidden" name="currency_code" id="CurrencySelector" value="USD" data-popout-input="" aria-label="currency_code">
</div>
</div>
</form>
POST /cart/update
<form method="post" action="/cart/update" id="currency_form" accept-charset="UTF-8" class="currency-selector small--hide" enctype="multipart/form-data"><input type="hidden" name="form_type" value="currency" aria-label="form_type"><input type="hidden"
name="utf8" value="✓" aria-label="utf8"><input type="hidden" name="return_to" value="/" aria-label="return_to"><input type="hidden" name="currency" value="CurrencyDrop" aria-label="currency"></form>
<form class="sc-1absc7o-2 kcotZO">
<div class="sc-1td5v5x-0 hOOaMS form-zone-element">
<div class="sc-1jzf0cm-0 gVCTVG yotpo-smsbump-email-input"><span class="sc-17eua8b-0 ieEBkw">
<div class="yotpo-smsbump-input__field-container"><span class="yotpo-smsbump-input__before"><span class="yotpo-smsbump-email-input__before"><svg width="18" height="12" viewBox="0 0 18 12" fill="none">
<path
d="M2.66659 0.666748H13.3333C14.0666 0.666748 14.6666 1.26675 14.6666 2.00008V10.0001C14.6666 10.7334 14.0666 11.3334 13.3333 11.3334H2.66659C1.93325 11.3334 1.33325 10.7334 1.33325 10.0001V2.00008C1.33325 1.26675 1.93325 0.666748 2.66659 0.666748Z"
stroke="rgba(0, 0, 0, 1)" stroke-linecap="round" stroke-linejoin="round"></path>
<path d="M14.6666 1L7.99992 5.66667L1.33325 1" stroke="rgba(0, 0, 0, 1)" stroke-linecap="round" stroke-linejoin="round"></path>
</svg></span></span><input placeholder="Enter your email address" aria-label="Email" required="" id="yotpo-smsbump-email-input__field" type="email" name="email" autocomplete="on" aria-invalid="false"
class="yotpo-smsbump-input__field yotpo-smsbump-email-input__field"></div>
</span></div>
</div>
<div class="sc-1q3i0hi-0 fCPKXX yotpo-smsbump-submit-button form-zone-element"><button type="primary" class="sc-1p0px7q-0 hdswUS sc-1q3i0hi-1 bTwErT">
<div class="sc-15mmw7k-0 hNwBxt"></div>
<div class="sc-1p0px7q-2 eaEfqi">
<div>
<p>CONTINUE</p>
</div>
</div>
</button></div>
</form>
Text Content
DEIN STANDORT IST AUF DEUTSCHLAND FESTGELEGT * In EUR € einkaufen * Versandoptionen für Deutschland anzeigen * Die Sprache ist auf Deutsch festgelegt Fortfahren Land/Region und Sprache ändern Back Accessibility options Are you sure you want to hide the widget forever? If you need it back, please clear your cookies. OkCancel Content Bigger Cursor Bigger Cursor Text Reader Tooltips Line Height Line Height Hide Images Hide images Readable Fonts Readable fonts Dyslexic Font Dyslexic Font Stop Animations Stop Animations Colors Invert Color Invert Colors Brightness Brightness Contrast Contrast Grayscale Color Grayscale Saturation Saturation Navigation Reading Line Reading Line Highlight Links Highlight Links Text Reader Read page Reading Mask Reading Mask Page Structure Page Structure LanguageEnglish (USA) Search language English (USA)SwedishFinnishGermanSpanishPortugueseTurkishFrenchJapaneseKoreanHebrewLatvianPolishGreekThai Accessibly App Accessibility Statement Accessibly App is committed to making sites accessible for all, including people with disabilities. We are continuously improving the service we provide through our app to comply with increased accessibility standards, guidelines, and to make the browsing experience better for everyone. Conformance status The app uses the Web Content Accessibility Guidelines (WCAG) defined requirements to improve accessibility for people with disabilities. It defines three levels of conformance: Level A, Level AA, and Level AAA. Accessibly App is following the best guidelines and is partially conformant with WCAG 2.1 level AA. Technical information Accessibly App is an app supported in Shopify and Wordpress environments. The app relies on the following technologies: HTML CSS JavaScript NodeJs MongoDB Accessibly App features When a site has Accessibly App i ac-h4 installed, the website can be adjusted with keyboard navigation using the “tab” key (WCAG 2.1/2.1.1). Additionally, see the list of all provided Accessibly App features and tools for better website experience: Zoom | WCAG 2.1 / 1.4.4 This feature enables users to enhance the size of the text to up to three times the original text for better text readability. Bigger cursor Makes the cursor bigger and more prominent. Increases the size for better site browsing. Invert colors Invert the colors of the website content. For those with decreased vision, the high contrast greatly helps to read the site better. Tweak Contrast | WCAG 2.1 / 1.4.6 This feature lets users manually select from two options: to enhance the contrast of the website or to decrease the contrast. Tweak Brightness | WCAG 2.1 / 1.4.6 This feature lets users update the brightness on the site. The content can either be made brighter or darker. Grayscale | WCAG 2.1 / 1.4.6 Users can turn on grayscale, making the website content appear only in shades of gray. This benefits people with visual impairment. Reading Line Add a supportive reading line to the site. Readable fonts Convert the fonts available on-site to one of the most easily readable fonts: Helvetica. Alt Text and Images Ability to read alt text of images. As of now, our tool has added a feature where alt descriptions for images without them are generated using Google's Vision AI. In the event that you haven't manually written these image descriptions yourself, this greatly helps people with visual impairment browse your site. Tooltips | WCAG 2.1 / 2.5.3 Add labels to images that contain a written description of the image. Highlight links Highlight links to make them more prominent. Hide images Hide images on the site. This provides better site readability for people with visual impairment. Read page A feature that allows a voice to read the text on your site out loud to visitors. Notes & Feedback We always try to update our services and operate in the best possible manner to benefit all of our clients and their site visitors. We cannot control or correct problems with third-party sites, but please let us know if you encounter difficulty with any sites we link to so we can pass the information along to the site owners. You may also want to address your concerns directly to these third parties. Reset settings Accessibility statement Skip to content This site has limited support for your browser. We recommend switching to Edge, Chrome, Safari, or Firefox. AMAZON PAY now available! Upgrading Our Delivery System: Apologies for High-Demand Delays. 🙏🙏 FREE SHIPPING on orders over $40 AMAZON PAY now available! Upgrading Our Delivery System: Apologies for High-Demand Delays. 🙏🙏 FREE SHIPPING on orders over $40 AMAZON PAY now available! Upgrading Our Delivery System: Apologies for High-Demand Delays. 🙏🙏 FREE SHIPPING on orders over $40 AMAZON PAY now available! Upgrading Our Delivery System: Apologies for High-Demand Delays. 🙏🙏 FREE SHIPPING on orders over $40 AMAZON PAY now available! Upgrading Our Delivery System: Apologies for High-Demand Delays. 🙏🙏 FREE SHIPPING on orders over $40 AMAZON PAY now available! Upgrading Our Delivery System: Apologies for High-Demand Delays. 🙏🙏 FREE SHIPPING on orders over $40 AMAZON PAY now available! Upgrading Our Delivery System: Apologies for High-Demand Delays. 🙏🙏 FREE SHIPPING on orders over $40 AMAZON PAY now available! Upgrading Our Delivery System: Apologies for High-Demand Delays. 🙏🙏 FREE SHIPPING on orders over $40 AMAZON PAY now available! Upgrading Our Delivery System: Apologies for High-Demand Delays. 🙏🙏 FREE SHIPPING on orders over $40 AMAZON PAY now available! Upgrading Our Delivery System: Apologies for High-Demand Delays. 🙏🙏 FREE SHIPPING on orders over $40 AMAZON PAY now available! Upgrading Our Delivery System: Apologies for High-Demand Delays. 🙏🙏 FREE SHIPPING on orders over $40 AMAZON PAY now available! Upgrading Our Delivery System: Apologies for High-Demand Delays. 🙏🙏 FREE SHIPPING on orders over $40 AMAZON PAY now available! Upgrading Our Delivery System: Apologies for High-Demand Delays. 🙏🙏 FREE SHIPPING on orders over $40 Close * USDARSEURGBPJPYMXNMYRCADAUDINRAEDBNDCHFEGPHKDIDRIQDJEPMADMWKMVRMURNTDNZDPHPRUBSARSGDSTDSZLSYPTHBTRYTNDTOPTWDVNDYERZMKZARAFNALLAMDANGAOAAWGAZNBAMBBDBDTBGNBHDBIFBMDBOBBRLBSDBTNBWPBYNBYRBZDCDFCLPCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDERNETBFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHNLHRKHTGHUFILSIMPIRRISKJMDJODKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMDLMGAMKDMMKMNTMOPMROMZNNADNGNNIONOKNPROMRPABPENPGKPKRPLNPYGQARRONRSDRWFSBDSCRSDGSEKSHPSLLSOSSPLSRDSVCTJSTMMTMTTTDTVDTZSUAHUGXUYUUZSVEFVUVWSTXAFXAGXAUXBTXCDXDRXOFXPDXPFXPTZMWZWD USD * USD * ARS * EUR * GBP * JPY * MXN * MYR * CAD * AUD * INR * AED * BND * CHF * EGP * HKD * IDR * IQD * JEP * MAD * MWK * MVR * MUR * NTD * NZD * PHP * RUB * SAR * SGD * STD * SZL * SYP * THB * TRY * TND * TOP * TWD * VND * YER * ZMK * ZAR * AFN * ALL * AMD * ANG * AOA * AWG * AZN * BAM * BBD * BDT * BGN * BHD * BIF * BMD * BOB * BRL * BSD * BTN * BWP * BYN * BYR * BZD * CDF * CLP * CNY * COP * CRC * CUC * CUP * CVE * CZK * DJF * DKK * DOP * DZD * ERN * ETB * FJD * FKP * GEL * GGP * GHS * GIP * GMD * GNF * GTQ * GYD * HNL * HRK * HTG * HUF * ILS * IMP * IRR * ISK * JMD * JOD * KES * KGS * KHR * KMF * KPW * KRW * KWD * KYD * KZT * LAK * LBP * LKR * LRD * LSL * LYD * MDL * MGA * MKD * MMK * MNT * MOP * MRO * MZN * NAD * NGN * NIO * NOK * NPR * OMR * PAB * PEN * PGK * PKR * PLN * PYG * QAR * RON * RSD * RWF * SBD * SCR * SDG * SEK * SHP * SLL * SOS * SPL * SRD * SVC * TJS * TMM * TMT * TTD * TVD * TZS * UAH * UGX * UYU * UZS * VEF * VUV * WST * XAF * XAG * XAU * XBT * XCD * XDR * XOF * XPD * XPF * XPT * ZMW * ZWD * Brands See More * VIEW ALL Brands A-Z See More * The SAEM * A'PIEU * COSRX * ETUDE HOUSE * Sulwhasoo * TONYMOLY * HERA * LANEIGE * MISSHA * Krave * Innisfree * OHUI * Benton * More + * Only At DODO See More * TAMBURINS * Bellboy Studio * HA'SOL * D’ALBA * Atomy * Dermamular * Daleaf * 3CE * MUZIGAE MANSION * Trendy Brands See More * MUZIGAE MANSION * D’ALBA * A'PIEU * AESTURA * ANUA * AMUSE * Beauty of Joseon * ROM&ND * hince * MEDI-PEEL * COSRX * SKIN1004 * ROUND LAB * MEDIHEAL * Dr.G * Torriden * Abib * 💝 Today's Deals See More * FLASH-TIME DEAL * BOGO 1+1 FREE * K-BEAUTY UNDER $10 * DODOBOX * 2024 SUMMER SEASON * NEAR EXPIRY BIG SALE * ROCKET-SPEED SHIPPING🚀 * LUX Gifts 💘 * Hot Rankings * Best * New In * Skincare See More * Cleansers See More * Exfoliators * Cleansing Foam * Cleansing Water/Lotion/Tissue * Cleansing Oil/Balm * Cleansing Cream/Gel * Facial Soap & ETC * Makeup Remover * Moisturizers See More * Skin/Toner/Mist * Lotion/Emulsion * Serum * Essence/Ampoule * Cream/Balm/Gel * Facial Oil * Eye & Neck Care * Lip Care * Pack/Mask * Set * Men * Baby * Special Care * Makeup See More * Face See More * Base/Primer * Cushion Pact/Puff * Foundation/BB/CC * Concealer * Powder/Fixer * Eye See More * Eyebrow * Eyeshadow * Eyeliner * Mascara * Lip See More * Lipstick/Rouge * Lip Tint * Balm/Gloss * Cheek See More * Blush * Highlighter * Contour * SPF Sun * Hair/Body See More * Hair Care See More * Shampoo * Conditioner * Hair Tonic * Treatments/Packs * Serum/Essence/Oil/Mist * Styling * Body See More * Body Care * Body Wash/Exfoliators * Hand/Foot * Tooth Care * Fragrance/Perfume * Devices/Tools See More * Beauty Device & Tools * Hair Styling Tools * Makeup Tools & Brushes * Cotton Pads & More * Wellness * USDARSEURGBPJPYMXNMYRCADAUDINRAEDBNDCHFEGPHKDIDRIQDJEPMADMWKMVRMURNTDNZDPHPRUBSARSGDSTDSZLSYPTHBTRYTNDTOPTWDVNDYERZMKZARAFNALLAMDANGAOAAWGAZNBAMBBDBDTBGNBHDBIFBMDBOBBRLBSDBTNBWPBYNBYRBZDCDFCLPCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDERNETBFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHNLHRKHTGHUFILSIMPIRRISKJMDJODKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMDLMGAMKDMMKMNTMOPMROMZNNADNGNNIONOKNPROMRPABPENPGKPKRPLNPYGQARRONRSDRWFSBDSCRSDGSEKSHPSLLSOSSPLSRDSVCTJSTMMTMTTTDTVDTZSUAHUGXUYUUZSVEFVUVWSTXAFXAGXAUXBTXCDXDRXOFXPDXPFXPTZMWZWD * Brands See More * VIEW ALL Brands A-Z See More * The SAEM * A'PIEU * COSRX * ETUDE HOUSE * Sulwhasoo * TONYMOLY * HERA * LANEIGE * MISSHA * Krave * Innisfree * OHUI * Benton * More + * Only At DODO See More * TAMBURINS * Bellboy Studio * HA'SOL * D’ALBA * Atomy * Dermamular * Daleaf * 3CE * MUZIGAE MANSION * Trendy Brands See More * MUZIGAE MANSION * D’ALBA * A'PIEU * AESTURA * ANUA * AMUSE * Beauty of Joseon * ROM&ND * hince * MEDI-PEEL * COSRX * SKIN1004 * ROUND LAB * MEDIHEAL * Dr.G * Torriden * Abib * 💝 Today's Deals See More * FLASH-TIME DEAL * BOGO 1+1 FREE * K-BEAUTY UNDER $10 * DODOBOX * 2024 SUMMER SEASON * NEAR EXPIRY BIG SALE * ROCKET-SPEED SHIPPING🚀 * LUX Gifts 💘 * Hot Rankings * Best * New In * Skincare See More * Cleansers See More * Exfoliators * Cleansing Foam * Cleansing Water/Lotion/Tissue * Cleansing Oil/Balm * Cleansing Cream/Gel * Facial Soap & ETC * Makeup Remover * Moisturizers See More * Skin/Toner/Mist * Lotion/Emulsion * Serum * Essence/Ampoule * Cream/Balm/Gel * Facial Oil * Eye & Neck Care * Lip Care * Pack/Mask * Set * Men * Baby * Special Care * Makeup See More * Face See More * Base/Primer * Cushion Pact/Puff * Foundation/BB/CC * Concealer * Powder/Fixer * Eye See More * Eyebrow * Eyeshadow * Eyeliner * Mascara * Lip See More * Lipstick/Rouge * Lip Tint * Balm/Gloss * Cheek See More * Blush * Highlighter * Contour * SPF Sun * Hair/Body See More * Hair Care See More * Shampoo * Conditioner * Hair Tonic * Treatments/Packs * Serum/Essence/Oil/Mist * Styling * Body See More * Body Care * Body Wash/Exfoliators * Hand/Foot * Tooth Care * Fragrance/Perfume * Devices/Tools See More * Beauty Device & Tools * Hair Styling Tools * Makeup Tools & Brushes * Cotton Pads & More * Wellness * USDARSEURGBPJPYMXNMYRCADAUDINRAEDBNDCHFEGPHKDIDRIQDJEPMADMWKMVRMURNTDNZDPHPRUBSARSGDSTDSZLSYPTHBTRYTNDTOPTWDVNDYERZMKZARAFNALLAMDANGAOAAWGAZNBAMBBDBDTBGNBHDBIFBMDBOBBRLBSDBTNBWPBYNBYRBZDCDFCLPCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDERNETBFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHNLHRKHTGHUFILSIMPIRRISKJMDJODKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMDLMGAMKDMMKMNTMOPMROMZNNADNGNNIONOKNPROMRPABPENPGKPKRPLNPYGQARRONRSDRWFSBDSCRSDGSEKSHPSLLSOSSPLSRDSVCTJSTMMTMTTTDTVDTZSUAHUGXUYUUZSVEFVUVWSTXAFXAGXAUXBTXCDXDRXOFXPDXPFXPTZMWZWD * Brands See More * VIEW ALL Brands A-Z See More * The SAEM * A'PIEU * COSRX * ETUDE HOUSE * Sulwhasoo * TONYMOLY * HERA * LANEIGE * MISSHA * Krave * Innisfree * OHUI * Benton * More + * Only At DODO See More * TAMBURINS * Bellboy Studio * HA'SOL * D’ALBA * Atomy * Dermamular * Daleaf * 3CE * MUZIGAE MANSION * Trendy Brands See More * MUZIGAE MANSION * D’ALBA * A'PIEU * AESTURA * ANUA * AMUSE * Beauty of Joseon * ROM&ND * hince * MEDI-PEEL * COSRX * SKIN1004 * ROUND LAB * MEDIHEAL * Dr.G * Torriden * Abib * 💝 Today's Deals See More * FLASH-TIME DEAL * BOGO 1+1 FREE * K-BEAUTY UNDER $10 * DODOBOX * 2024 SUMMER SEASON * NEAR EXPIRY BIG SALE * ROCKET-SPEED SHIPPING🚀 * LUX Gifts 💘 * Hot Rankings * Best * New In * Skincare See More * Cleansers See More * Exfoliators * Cleansing Foam * Cleansing Water/Lotion/Tissue * Cleansing Oil/Balm * Cleansing Cream/Gel * Facial Soap & ETC * Makeup Remover * Moisturizers See More * Skin/Toner/Mist * Lotion/Emulsion * Serum * Essence/Ampoule * Cream/Balm/Gel * Facial Oil * Eye & Neck Care * Lip Care * Pack/Mask * Set * Men * Baby * Special Care * Makeup See More * Face See More * Base/Primer * Cushion Pact/Puff * Foundation/BB/CC * Concealer * Powder/Fixer * Eye See More * Eyebrow * Eyeshadow * Eyeliner * Mascara * Lip See More * Lipstick/Rouge * Lip Tint * Balm/Gloss * Cheek See More * Blush * Highlighter * Contour * SPF Sun * Hair/Body See More * Hair Care See More * Shampoo * Conditioner * Hair Tonic * Treatments/Packs * Serum/Essence/Oil/Mist * Styling * Body See More * Body Care * Body Wash/Exfoliators * Hand/Foot * Tooth Care * Fragrance/Perfume * Devices/Tools See More * Beauty Device & Tools * Hair Styling Tools * Makeup Tools & Brushes * Cotton Pads & More * Wellness * USDARSEURGBPJPYMXNMYRCADAUDINRAEDBNDCHFEGPHKDIDRIQDJEPMADMWKMVRMURNTDNZDPHPRUBSARSGDSTDSZLSYPTHBTRYTNDTOPTWDVNDYERZMKZARAFNALLAMDANGAOAAWGAZNBAMBBDBDTBGNBHDBIFBMDBOBBRLBSDBTNBWPBYNBYRBZDCDFCLPCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDERNETBFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHNLHRKHTGHUFILSIMPIRRISKJMDJODKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMDLMGAMKDMMKMNTMOPMROMZNNADNGNNIONOKNPROMRPABPENPGKPKRPLNPYGQARRONRSDRWFSBDSCRSDGSEKSHPSLLSOSSPLSRDSVCTJSTMMTMTTTDTVDTZSUAHUGXUYUUZSVEFVUVWSTXAFXAGXAUXBTXCDXDRXOFXPDXPFXPTZMWZWD * Log in * Create account * Search Apply discount codes for single-item purchases at checkout page. YOUR CART0 ITEMS Spend $40 more for FREE shipping.FREE shipping will be applied at checkout Sorry, looks like we don't have enough of this product. Your cart is currently empty. Brands 💝 Today's Deals Hot Rankings Add order notes Special instructions for seller Is this a gift? Add a note. Add a note for recipient Items Free Apply CheckoutFree Volume discounts will be applied during the final checkout. Shipping & taxes calculated at checkout Open navigation menu Open search bar Search for products on our site Open cart My Account Brands VIEW ALL Brands A-Z The SAEM A'PIEU COSRX ETUDE HOUSE Sulwhasoo TONYMOLY HERA LANEIGE MISSHA Krave Innisfree OHUI Benton More + Only At DODO TAMBURINS Bellboy Studio HA'SOL D’ALBA Atomy Dermamular Daleaf 3CE MUZIGAE MANSION Trendy Brands MUZIGAE MANSION D’ALBA A'PIEU AESTURA ANUA AMUSE Beauty of Joseon ROM&ND hince MEDI-PEEL COSRX SKIN1004 ROUND LAB MEDIHEAL Dr.G Torriden Abib 💝 Today's Deals FLASH-TIME DEAL BOGO 1+1 FREE K-BEAUTY UNDER $10 DODOBOX 2024 SUMMER SEASON NEAR EXPIRY BIG SALE ROCKET-SPEED SHIPPING🚀 LUX Gifts 💘 Hot Rankings Best New In Skincare Cleansers Exfoliators Cleansing Foam Cleansing Water/Lotion/Tissue Cleansing Oil/Balm Cleansing Cream/Gel Facial Soap & ETC Makeup Remover Moisturizers Skin/Toner/Mist Lotion/Emulsion Serum Essence/Ampoule Cream/Balm/Gel Facial Oil Eye & Neck Care Lip Care Pack/Mask Set Men Baby Special Care Makeup Face Base/Primer Cushion Pact/Puff Foundation/BB/CC Concealer Powder/Fixer Eye Eyebrow Eyeshadow Eyeliner Mascara Lip Lipstick/Rouge Lip Tint Balm/Gloss Cheek Blush Highlighter Contour SPF Sun Hair/Body Hair Care Shampoo Conditioner Hair Tonic Treatments/Packs Serum/Essence/Oil/Mist Styling Body Body Care Body Wash/Exfoliators Hand/Foot Tooth Care Fragrance/Perfume Devices/Tools Beauty Device & Tools Hair Styling Tools Makeup Tools & Brushes Cotton Pads & More Wellness Brands VIEW ALL Brands A-Z The SAEM A'PIEU COSRX ETUDE HOUSE Sulwhasoo TONYMOLY HERA LANEIGE MISSHA Krave Innisfree OHUI Benton More + Only At DODO TAMBURINS Bellboy Studio HA'SOL D’ALBA Atomy Dermamular Daleaf 3CE MUZIGAE MANSION Trendy Brands MUZIGAE MANSION D’ALBA A'PIEU AESTURA ANUA AMUSE Beauty of Joseon ROM&ND hince MEDI-PEEL COSRX SKIN1004 ROUND LAB MEDIHEAL Dr.G Torriden Abib 💝 Today's Deals FLASH-TIME DEAL BOGO 1+1 FREE K-BEAUTY UNDER $10 DODOBOX 2024 SUMMER SEASON NEAR EXPIRY BIG SALE ROCKET-SPEED SHIPPING🚀 LUX Gifts 💘 Hot Rankings Best New In Skincare Cleansers Exfoliators Cleansing Foam Cleansing Water/Lotion/Tissue Cleansing Oil/Balm Cleansing Cream/Gel Facial Soap & ETC Makeup Remover Moisturizers Skin/Toner/Mist Lotion/Emulsion Serum Essence/Ampoule Cream/Balm/Gel Facial Oil Eye & Neck Care Lip Care Pack/Mask Set Men Baby Special Care Makeup Face Base/Primer Cushion Pact/Puff Foundation/BB/CC Concealer Powder/Fixer Eye Eyebrow Eyeshadow Eyeliner Mascara Lip Lipstick/Rouge Lip Tint Balm/Gloss Cheek Blush Highlighter Contour SPF Sun Hair/Body Hair Care Shampoo Conditioner Hair Tonic Treatments/Packs Serum/Essence/Oil/Mist Styling Body Body Care Body Wash/Exfoliators Hand/Foot Tooth Care Fragrance/Perfume Devices/Tools Beauty Device & Tools Hair Styling Tools Makeup Tools & Brushes Cotton Pads & More Wellness Brands VIEW ALL Brands A-Z The SAEM A'PIEU COSRX ETUDE HOUSE Sulwhasoo TONYMOLY HERA LANEIGE MISSHA Krave Innisfree OHUI Benton More + Only At DODO TAMBURINS Bellboy Studio HA'SOL D’ALBA Atomy Dermamular Daleaf 3CE MUZIGAE MANSION Trendy Brands MUZIGAE MANSION D’ALBA A'PIEU AESTURA ANUA AMUSE Beauty of Joseon ROM&ND hince MEDI-PEEL COSRX SKIN1004 ROUND LAB MEDIHEAL Dr.G Torriden Abib 💝 Today's Deals FLASH-TIME DEAL BOGO 1+1 FREE K-BEAUTY UNDER $10 DODOBOX 2024 SUMMER SEASON NEAR EXPIRY BIG SALE ROCKET-SPEED SHIPPING🚀 LUX Gifts 💘 Hot Rankings Best New In Skincare Cleansers Exfoliators Cleansing Foam Cleansing Water/Lotion/Tissue Cleansing Oil/Balm Cleansing Cream/Gel Facial Soap & ETC Makeup Remover Moisturizers Skin/Toner/Mist Lotion/Emulsion Serum Essence/Ampoule Cream/Balm/Gel Facial Oil Eye & Neck Care Lip Care Pack/Mask Set Men Baby Special Care Makeup Face Base/Primer Cushion Pact/Puff Foundation/BB/CC Concealer Powder/Fixer Eye Eyebrow Eyeshadow Eyeliner Mascara Lip Lipstick/Rouge Lip Tint Balm/Gloss Cheek Blush Highlighter Contour SPF Sun Hair/Body Hair Care Shampoo Conditioner Hair Tonic Treatments/Packs Serum/Essence/Oil/Mist Styling Body Body Care Body Wash/Exfoliators Hand/Foot Tooth Care Fragrance/Perfume Devices/Tools Beauty Device & Tools Hair Styling Tools Makeup Tools & Brushes Cotton Pads & More Wellness Open search bar Search for products on our site My Account Open cart Open search bar Search for products on our site Open cart Open navigation menu 🚀💨 Get an EXTRA 10% OFF our Rocket Delivery Collection! Use code RDFRESH10 🚀💨 Get an EXTRA 10% OFF our Rocket Delivery Collection! Use code RDFRESH10 false ROM&ND - MOIST AND TRANSLUCENT SKIN, AS IF IT HAS ABSORBED WATER false INCELLDERM - THE MILLION-SELLING SENSATION! CHANCE TO EXCELLENCE! false SAME-DAY ROCKET DISPATCH - USE CODE RDFRESH10 FOR AN EXTRA 10% OFF false INNISFREE - REVITALIZE WITH VITAMIN C GREEN TEA ENZYME BRIGHTENING SERUM false BORNTOSTANDOUT - COTTON CANDY. NAIL POLISH. FRESH PAINT. THE SCENTS OF SECRET PLEASURES. false D’ALBA - NEW GENERATION COLLAGEN 'PLANT COLLAGEN BOOSTER' false LUX GIFT - HERE'S A SWEET GIFT FROM US TO YOU SPF SUNCARE BODY MOISTURIZERS CLEANSING FOAM/PAD CUSHION PACT/PUFF LIP BEAUTY DEVICES HAIR CARE 🐥 EARLY BIRD DEALS ON 2024' K-BEAUTY TODAY💖 - * 1+1 BOGO * FLASH-TIME DEAL * SHIP TODAY MORE DEALS MORE DEALS MORE DEALS 💛1+1💛 PURITO Wonder Releaf Centella Toner Unscented 200ml Quick Buy PURITO💛1+1💛 purito wonder releaf centella toner unscented 200ml $58.68 $85.02 Save 30% 💛1+1💛 mixsoon Bifida Cream 60ml Sold Out Quick Buy mixsoon💛1+1💛 mixsoon bifida cream 60ml $59.40 $79.98 Save 25% 💛1+1💛 HEIMISH Matcha Biome Amino Acne Cleansing Foam 150g Quick Buy Heimish💛1+1💛 heimish matcha biome amino acne cleansing foam 150g $48.58 $75.08 Save 35% 💛1+1💛 HEIMISH Marine Care Retinol Eye Serum 30ml Quick Buy Heimish💛1+1💛 heimish marine care retinol eye serum 30ml $50.04 $73.98 Save 32% ★time deal★ The History of Whoo Gongjinhyang Mi Two Way Pact 13g SPF30 - DODOSKIN Quick Buy The History Of Whoo★time deal★ the history of whoo gongjinhyang mi two way pact 13g spf30 $62.99 $79.86 Save up to 21% MISSHA All Around Safe Block Aqua Sun SPF50+ PA++++ 50ml - Dodoskin Quick Buy MISSHA★time deal★ missha all around safe block aqua sun spf50+ pa++++ 50ml $9.40 $18.95 Save 50% Melixir Vegan Lip Butter 3.9g - DODOSKIN Quick Buy Melixir★time deal★ melixir vegan lip butter 3.9g $11.70 $21.00 Save up to 44% Torriden DIVE-IN Low Molecule Hyaluronic Acid Skin Booster 200ml - DODOSKIN Sold Out Quick Buy Torriden★time deal★ torriden dive-in low molecule hyaluronic acid skin booster 200ml $22.01 $36.10 Save 39% mixsoon Bean Essence 50ml - DODOSKIN Quick Buy mixsoonMixsoon bean essence 50ml $34.99 $46.59 5.0 Save 24% BUSAN 19 Available mixsoon Bean Essence 30ml - Dodoskin Quick Buy mixsoonMixsoon bean essence 30ml $28.47 $37.95 5.0 Save 24% 39 Available [US STOCK] COSRX Patch Set (Acne Pimple 24ea*3 + Clear Fit Master 18ea*1) - DODOSKIN Quick Buy COSRXCosrx patch set (acne pimple 24ea*3 + clear fit master 18ea*1) $10.88 $28.99 5.0 Save 62% USA 236 Available [US STOCK] COSRX Advanced Snail 92 All in One Cream Tube 200g - DODOSKIN Quick Buy COSRXCosrx advanced snail 92 all in one cream tube 200g $20.33 $35.61 4.8 Save 42% USA 25 Available COSRX BHA Blackhead Power Liquid 100ml - Dodoskin Quick Buy COSRXCosrx bha blackhead power liquid 100ml $18.74 $27.83 5.0 Save 32% COSRX AHA/BHA Clarifying Treatment Toner 150ml - Dodoskin Quick Buy COSRXCosrx aha/bha clarifying treatment toner 150ml $18.79 $29.52 5.0 Save 36% COSRX Balancium Comfort Ceramide Cream 80g - Dodoskin Quick Buy COSRXCosrx balancium comfort ceramide cream 80g $16.13 $27.00 5.0 Save 40% COSRX Hyaluronic Acid Intensive Cream 100g - Dodoskin Quick Buy COSRXCosrx hyaluronic acid intensive cream 100g $19.21 $27.12 5.0 Save 29% COSRX Centella Blemish Cream 30g - Dodoskin Quick Buy COSRXCosrx centella blemish cream 30g $15.06 $25.87 4.9 Save 41% COSRX Advanced Snail 96 Mucin Power Essence 100ml - Dodoskin Quick Buy COSRXCosrx advanced snail 96 mucin power essence 100ml $17.84 $27.49 4.8 Save 35% COSRX Galactomyces 95 Tone Balancing Essence 100ml - Dodoskin Quick Buy COSRXCosrx galactomyces 95 tone balancing essence 100ml $18.84 $29.97 5.0 Save 37% COSRX Low pH Good Morning Gel Cleanser 150ml - Dodoskin Quick Buy COSRXCosrx low ph good morning gel cleanser 150ml $17.15 $28.40 4.9 Save 39% TODAY'S K-BEAUTY UPDATES! SHOW MORE LANEIGE Water Bank Blue Hyaluronic Cream 50ml (3types) Quick Buy LANEIGELaneige water bank blue hyaluronic cream 50ml (3types) From $29.39 Save up to 22% Glampalm GP201 Signature 1 Inch (2 Colors) Quick Buy GlampalmGlampalm gp201 signature 1 inch (2 colors) $220.00 $265.15 4.9 Save up to 17% Banila Co Priming Veil Cheek 6g (6 Colors) Quick Buy BANILA COBanila co priming veil cheek 6g (6 colors) $14.15 $22.15 Save up to 36% JUNGSAEMMOOL Sunsual Eyes Sun Stick SPF 50+ PA++++ 16g Quick Buy JUNGSAEMMOOLJungsaemmool sunsual eyes sun stick spf 50+ pa++++ 16g $21.10 $27.48 Save 23% Hince Dewy Liquid Cheek 6ml (5 Colors) Quick Buy hinceHince dewy liquid cheek 6ml (5 colors) $18.70 $26.70 Save up to 29% Chahong Flexible Curl Cream 120ml/150ml Quick Buy CHAHONGChahong flexible curl cream 120ml/150ml From $21.60 Save up to 27% Manyo Factory Bifida Biome Concentrate Cream 50ml Quick Buy MANYO FACTORYManyo factory bifida biome concentrate cream 50ml $23.00 $30.00 Save 23% ETUDE HOUSE Soon Jung X Director's Moisture Sun cream 1+1 Special Set 50ml+50ml Quick Buy Etude HouseEtude house soon jung x director's moisture sun cream 1+1 special set 50ml+50ml $23.54 $34.15 Save 31% Chahong Fix Volume Spray 150ml/250ml Quick Buy CHAHONGChahong fix volume spray 150ml/250ml From $16.00 Save up to 33% Narka Core Rebuild Hype Fit Hair Mascara Quick Buy NARKANarka core rebuild hype fit hair mascara $23.00 $31.00 Save 25% W.DRESSROOM Natural Life Perfume bag 10g (3 Types) Quick Buy W.DRESSROOMW.dressroom natural life perfume bag 10g (3 types) $12.64 $19.99 Save up to 36% the SAEM Cover Perfection Pot Concealer 6g (Renewal) Quick Buy The SAEMThe saem cover perfection pot concealer 6g (renewal) $6.99 $9.66 Save up to 27% 18 Available O HUI Miracle Moisture Lipcerin 15ml Quick Buy O HUIO hui miracle moisture lipcerin 15ml $20.99 $32.45 Save 35% Fillimilli Ceramic Body Massager Quick Buy FILLIMILLIFillimilli ceramic body massager $18.00 $26.00 Save 30% The Tool Lab Long All Day Fitting Duo (Powdery/Glowy/Cover) Quick Buy THE TOOL LABThe tool lab long all day fitting duo (powdery/glowy/cover) From $23.36 Save up to 25% Too Cool For School Artclass Brow Designing Pencil 0.18g (3colors) - DODOSKIN Quick Buy TOO COOL FOR SCHOOLToo cool for school artclass brow designing pencil 0.18g (3colors) $12.99 $16.00 Save up to 18% The Tool Lab Long Lasting Puff (Cover/Original/Glow) - DODOSKIN Quick Buy THE TOOL LABThe tool lab long lasting puff (cover/original/glow) $12.25 $20.25 Save up to 39% Studio17 Portable Makeup Brush Set (5 Pcs) - DODOSKIN Quick Buy STUDIO17Studio17 portable makeup brush set (5 pcs) $19.65 $27.65 Save 28% Studio17 Brush & Puff Cleanser - DODOSKIN Quick Buy STUDIO17Studio17 brush & puff cleanser $16.60 $24.60 Save 32% Lilybyred Sweet Liar Milky Tint 4g (8 colors) - DODOSKIN Quick Buy LILYBYREDLilybyred sweet liar milky tint 4g (8 colors) $16.95 $24.95 Save up to 32% Peripera Over Blur Tint 3.5g (7 Colors) Quick Buy PERIPERAPeripera over blur tint 3.5g (7 colors) $17.50 $25.50 Save up to 31% PERIPERA Ink The Velvet 4g (5 Colors) Quick Buy PERIPERAPeripera ink the velvet 4g (5 colors) $15.68 $23.68 Save up to 33% Dinto Bronte Melting Glow Lip Balm 1.7g (10 colors) - DODOSKIN Quick Buy DintoDinto bronte melting glow lip balm 1.7g (10 colors) $14.64 $21.15 Save up to 30% LE PERSONA Discovery Set | eau de parfum (3ml/10ml)*4 - DODOSKIN Quick Buy LE PERSONALe persona discovery set | eau de parfum (3ml/10ml)*4 From $41.99 Save up to 15% LE PERSONA LP04 GOLDEN GEM | eau de parfum 10ml / 50ml - DODOSKIN Quick Buy LE PERSONALe persona lp04 golden gem | eau de parfum 10ml / 50ml From $40.99 Save up to 11% LE PERSONA LP03 Wooden Face | eau de parfum 10ml / 50ml - DODOSKIN Quick Buy LE PERSONALe persona lp03 wooden face | eau de parfum 10ml / 50ml From $40.99 Save up to 11% LE PERSONA LP02 Peacock Feather | eau de parfum 10ml /50ml - DODOSKIN Quick Buy LE PERSONALe persona lp02 peacock feather | eau de parfum 10ml /50ml From $40.99 Save up to 11% K-BEAUTY BEST SELLERS Show More CNP Laboratory Propolis Lipcerin 15ml - DODOSKIN Quick Buy CNP LaboratoryCnp laboratory propolis lipcerin 15ml $17.99 $23.00 4.8 Save 21% Anua Cleansing SET (Heartleaf Cleansing Oil+Heartleaf Quercetinol Foam) - DODOSKIN Quick Buy ANUAAnua cleansing set (cleansing oil+foam) $49.99 $65.98 5.0 Save up to 24% ma:nyo Pure Cleansing Oil 200ml - Dodoskin Quick Buy MANYO FACTORYManyo factory pure cleansing oil 200ml $25.31 $36.98 5.0 Save 31% 52 Available TAMBURINS Egg Lip Balm (4 Types) - DODOSKIN Quick Buy TAMBURINSTamburins egg lip balm (4 types) $30.12 $38.69 Save up to 22% USA ROUND LAB Dokdo Cleanser 150ml - Dodoskin Quick Buy ROUND LABRound lab dokdo cleanser 150ml/200ml From $20.78 5.0 Save up to 30% TAMBURINS THE SHELL Perfume Hand 15ml (8 types) - Dodoskin Quick Buy TAMBURINSTamburins the shell perfume hand 15ml (8 types) $18.90 $22.00 Save up to 14% USA TAMBURINS Hand Perfumed Sanitizer Gel 30ml #000 - Dodoskin Quick Buy TAMBURINSTamburins hand perfumed sanitizer gel 30ml #000 $9.89 $15.98 5.0 Save 38% USA 20 Available Sulwhasoo Gentle Cleansing Foam (200ml) - Dodoskin Quick Buy SulwhasooSulwhasoo gentle cleansing foam 200ml $28.00 $56.00 5.0 Save 50% 80 Available BRAND MEDICUBE Korean Beauty Tech Device. Shop Now Collection KOREAN FRAGRANCE Shop Now COLLECTION K-MAKE UP SHOP NOW SPECIAL KOREAN BEAUTY CUSHION Show More K-BEAUTY BRANDS & STORIES GLAMPALM : THE BEST HAIR IRONS AMONG K-POP IDOL HAIRSTYLISTS! June 01, 2024 Hey there, K-pop enthusiasts and hair aficionados! Are you ready to dive into the glamorous world of K-pop idol hair? Buckle up because we're about to spill the tea on the not-so-secret weapon behind those... THE BEST KOREAN SUNSCREENS FOR SUMMERS May 31, 2024 Korean sunscreens for summers Korean sunscreens are considered some of the best in the world for several reasons. Firstly, they are known for their lightweight and easily absorbable formulas that provide superior protection against harmful... BEST KOREAN SHAMPOOS FOR HEALTHY HAIR May 21, 2024 Korean Haircare Korean haircare has gained a lot of popularity in recent years thanks to Korean beauty trends taking over the world. People are turning to Korean haircare products for their innovative ingredients and effective... MEDICUBE COLLAGEN JELLY CREAM - DODOSKIN May 14, 2024 1. Medicube Collagen Niacinamide Jelly Cream Introducing the Medicube Collagen Jelly Cream, a Korean beauty product that promises a glass glow effect with its innovative formula. This cream is packed with powerful ingredients such... View all posts WHO USES WHAT? DISCOVERING K-POP & CELEBRITY BEAUTY FAVORITES BLACKPINK'S JENNIE DAZZLES WITH SPARKLY EYESHADOW AT MET GALA 202 May 06, 2024 The Met Gala 2024 proved to be a night of unforgettable glamour, and one star who truly stole the spotlight was BLACKPINK's Jennie. Known for her impeccable fashion sense and magnetic stage presence, Jennie brought... THE ENDURING CHARM OF BAE SUZY: SOUTH KOREA'S DARLING OF CLEAN BEAUTY April 08, 2024 Image source @SBS In the ever-evolving world of South Korean entertainment, few stars have shone as brightly and consistently as Bae Suzy. Known mononymously as Suzy, her journey from being a member of the popular girl... LE SSERAFIM'S SAKURA SHARES HER KOREAN SKINCARE AND BEAUTY TIPS WITH VOGUE March 13, 2024 LE SSERAFIM'S SAKURA Korean Skincare Regimen In the feature, LE SSERAFIM's SAKURA delves into her beauty and skincare regimen, emphasizing her minimalist makeup approach and her journey towards achieving her signature glow. She begins by... View all posts K-BEAUTY DODO PROMOTIONS INCELLDERM MILLION SELLER EVENT May 27, 2024 Incellderm Million Seller EventMAY 27 - JUNE 6, 2024 PST INNISFREE VITAMIN C SERUM SALE EVENT May 27, 2024 Innisfree Vitamin C Serum Sale EventMAY 27 - JUNE 6, 2024 PST SULWHASOO CUSHION & DUO SALE EVENT **END May 17, 2024 Sulwhasoo Cushion & Duo Sale EventMAY 17 - MAY 26, 2024 PST OAT SO SIMPLE WATER CREAM SALE EVENT **END May 17, 2024 Oat So Simple Water Cream Sale EventMAY 17 - MAY 26, 2024 PST View all posts FEATURED IN THE BRANDS WITH LOVE! TIKTOK : CUSTOMER HAPPINESS EFFORTS BEHIND-THE-SCENES! ❮ ❯ NEWSLETTER Sign up for exclusive deals and early access to new products. Sign up Email is invalid or already taken. LET CUSTOMERS SPEAK FOR US from 11036 reviews Verified by wow Quick and efficient! Medicube AGE-R Booster Pro was at my doorstep in no time. The fast delivery exceeded my expectations. Great job! Anna L. Medicube AGE-R Booster Pro 03/13/2024 Repaired my skin! Used this for a year and it took awhile but eventually applying this twice a day helped clear my scars and blemishes. 10/10 recommend! C.A. SOME BY MI Snail Truecica Miracle Repair Cream 60g 02/29/2024 Wonderful product My sister uses this on a daily basis, I don't due to laziness forgetfulness, but we have both purchased this twice. I have combi skin so the formulation works for me. C.F. ETUDE HOUSE Sunprise Mild Watery Light SPF50+/PA++++ 50g 02/29/2024 Works well I’m actually repurchasing this one god is so freaking good and it’s so big too it last so long cause a little goes a long way and it does so good for my skin it makes it so glow just the best thing that happened to me. A. SKIN1004 Madagascar Centella Toning Toner 210ml 02/27/2024 Nice product I got this product as a daily free gift and forgot to review it! But this one of the best cleansing wipes I've ever used. It refreshed my skin and definitely feels softer after using it and it did not dry my skin. I just wished there was more in the packet but I will definitely be buying some more! pappu l. THE FACE SHOP Herb Day Cleansing Tissue (70sheets) 02/25/2024 Great The size of the pack is bulkier than I expected bigger than the plus size iPhone, but it does its job well. I would use this when travelling but if you can find so, etching in a smaller size that would be better. J.K. THE FACE SHOP Herb Day Cleansing Tissue (70sheets) 02/25/2024 In love with these! Got this as a daily free gift, and wow these cleansing tissue was the best, it wasn't drying, and face gets really soft after you've use it. We'll definitely buy for more! Kudsia THE FACE SHOP Herb Day Cleansing Tissue (70sheets) 02/25/2024 2nd time purchasing I was glad to find this on here as I'd bought my previous one in person. very lightweight, creamy, but leaves my skin feeling dewy especially combined with the toner and serum. A. THE FACE SHOP The Therapy Royal Made Moisture Blending Formula Cream 50ml 02/25/2024 Seller review is that it arrived quickly within a week from ordering overseas. Device review still a bit early to decide but it pairs well with the app and offers a good routine if you are not sure about what to do. Marwa Medicube AGE-R Booster Pro 01/12/2024 About * About us * Contact * Notice * Affiliate & Ambassador * Wholesale B2B Help * Shipping Policy * Return & Exchange * Notice * FAQ My Account * Cart * Order History * My Account * Ranking * US Stock Our Policies * Privacy Policy * Terms and Conditions * Accessibility Newsletter Stay up to date with the new collections, products and exclusive offers. Subscribe to Our Newsletter Email is invalid or already taken. LANGUAGE English * English * français * 日本語 * Español * العربية * Deutsch CURRENCY USD $ * AED د.إ * AFN ؋ * ALL L * AMD դր. * ANG ƒ * ARS $ * AUD $ * AWG ƒ * AZN ₼ * BAM КМ * BBD $ * BDT ৳ * BGN лв. * BIF Fr * BND $ * BOB Bs. * BRL R$ * BSD $ * BWP P * BZD $ * CAD $ * CDF Fr * CHF CHF * CNY ¥ * CRC ₡ * CVE $ * CZK Kč * DJF Fdj * DKK kr. * DOP $ * DZD د.ج * EGP ج.م * ETB Br * EUR € * FJD $ * FKP £ * GBP £ * GMD D * GNF Fr * GTQ Q * GYD $ * HKD $ * HNL L * HUF Ft * IDR Rp * ILS ₪ * INR ₹ * ISK kr * JMD $ * JPY ¥ * KES KSh * KGS som * KHR ៛ * KMF Fr * KYD $ * KZT 〒 * LAK ₭ * LBP ل.ل * LKR ₨ * MAD د.م. * MDL L * MKD ден * MNT ₮ * MOP P * MUR ₨ * MVR MVR * MWK MK * MXN $ * MYR RM * NGN ₦ * NIO C$ * NPR ₨ * NZD $ * PEN S/. * PGK K * PHP ₱ * PKR ₨ * PLN zł * PYG ₲ * QAR ر.ق * RON Lei * RSD РСД * RWF FRw * SAR ر.س * SBD $ * SEK kr * SGD $ * SHP £ * SLL Le * STD Db * THB ฿ * TJS ЅМ * TOP T$ * TTD $ * TWD $ * TZS Sh * UAH ₴ * UGX USh * USD $ * UYU $ * UZS * VND ₫ * VUV Vt * WST T * XAF Fr * XCD $ * XOF Fr * XPF Fr * YER ﷼ © 2024, DODOGLOBAL, Inc. All rights reserved. cs@dodoskin.com * Amazon * American Express * Apple Pay * Diners Club * Discover * Meta Pay * Google Pay * Mastercard * PayPal * Shop Pay * Venmo * Visa * Home * Shop * Deal * Wishlist * Me Close Close {"themeColor":"#000000","iconColor":"#000000","showLogo":true,"topBottomPosition":10,"rightLeftPosition":10,"iconSize":"extra-small","iconCustomSize":27,"position":"bottom-left"} Judge.me Receive an extra 5% off as a welcome bonus & a birthday gift ! Extra 5%OFF your first order Unlock your exclusive K-beauty adventure here! Delve into a world of special bonuses and your personal secret code, waiting just for you. CONTINUE ← X →