westlakevillageinn-chrisschmittphotography-com.filesusr.com
AMAZON-02, US


Seen 2 times between May 12th, 2024 and May 14th, 2024.


Live Screenshot Hover to expand

Attention: This is a live snapshot of this website, we do not host or control it!

No direct hits
Nothing is hosted on this domain

Incoming hits
Summary of pages that talked to this domain

ASNs AS15169 | 1x AS396982 | 1x

IPs 34.149.87.45 | 2x

Domains westlakevillageinn.chrisschmittphotography.com | 2x

Countries US | 2x

Recent scans (2 total) Show all

URL Age
westlakevillageinn.chrisschmittphotography.com 8 months
westlakevillageinn.chrisschmittphotography.com 8 months

Disclaimer

The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.

Related screenshots
Screenshots of pages that talked to this domain

DNS recordsRetrieved via DNS ANY query

CNAME d1buhjvxj128v2.cloudfront.net

WHOIS for westlakevillageinn-chrisschmittphotography-com.filesusr.com

Rate limit exceeded. Try again after: 24h0m0s