wemakelandingpages.com
GOOGLE-CLOUD-PLATFORM, US


Seen 18 times between May 7th, 2020 and October 22nd, 2024.


General Info Open in Search

Geo Dallas, Texas, United States (US) —
AS AS396982 - GOOGLE-CLOUD-PLATFORM, US
Note: An IP might be announced by multiple ASs. This is not shown.
Route 34.168.0.0/13 (Route of ASN)
PTR 225.224.174.34.bc.googleusercontent.com(PTR record of primary IP)
IPv4 34.174.224.225 

Live Screenshot Hover to expand

Attention: This is a live snapshot of this website, we do not host or control it!

No direct hits
Nothing is hosted on this domain

Incoming hits
Summary of pages that talked to this domain

ASNs AS26496 | 13x AS46606 | 3x AS398101 | 2x

IPs 132.148.192.31 | 13x 162.214.93.196 | 3x 173.201.253.133 | 2x

Domains covid19-sanitizing.com | 14x puretouchcleaningservice.org | 4x

Countries US | 18x

Recent scans (18 total) Show all

URL Age
puretouchcleaningservice.org 2 months
puretouchcleaningservice.org 2 months
puretouchcleaningservice.org 2 years
puretouchcleaningservice.org 3 years
covid19-sanitizing.com 4 years

Disclaimer

The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.

Recently observed hostnames on 'wemakelandingpages.com'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.

covid19-sanitizing.wemakelandingpages.com | 2021-06-13 www.covid19-sanitizing.wemakelandingpages.com | 2021-06-13 palmbeachcountytreetrimming.wemakelandingpages.com | 2021-04-13 www.palmbeachcountytreetrimming.wemakelandingpages.com | 2021-04-13 decorallure.wemakelandingpages.com | 2021-04-12 www.decorallure.wemakelandingpages.com | 2021-04-12 jaghauling.wemakelandingpages.com | 2021-04-11 www.jaghauling.wemakelandingpages.com | 2021-04-11 jagtree.wemakelandingpages.com | 2021-04-10 www.jagtree.wemakelandingpages.com | 2021-04-10 puretouchcleaningservice.wemakelandingpages.com | 2021-04-10 www.puretouchcleaningservice.wemakelandingpages.com | 2021-04-10 treeremovalpalmbeachcounty.wemakelandingpages.com | 2021-04-09 www.treeremovalpalmbeachcounty.wemakelandingpages.com | 2021-04-09 deerfieldbeacharboretum.wemakelandingpages.com | 2021-04-09 www.deerfieldbeacharboretum.wemakelandingpages.com | 2021-04-09 candacelargent.wemakelandingpages.com | 2021-04-09 www.candacelargent.wemakelandingpages.com | 2021-04-09 azpromotionsllc.wemakelandingpages.com | 2021-04-09 www.azpromotionsllc.wemakelandingpages.com | 2021-04-09 alltechairandheat.wemakelandingpages.com | 2021-04-09 www.alltechairandheat.wemakelandingpages.com | 2021-04-09 918trees.wemakelandingpages.com | 2021-04-09 www.918trees.wemakelandingpages.com | 2021-04-09 smartgirlfoods.wemakelandingpages.com | 2021-04-04 www.smartgirlfoods.wemakelandingpages.com | 2021-04-04 rylieslandscapeanddesign.wemakelandingpages.com | 2021-04-04 www.rylieslandscapeanddesign.wemakelandingpages.com | 2021-04-04 autodiscover.wemakelandingpages.com | 2021-04-04 cpanel.wemakelandingpages.com | 2021-04-04 cpcalendars.wemakelandingpages.com | 2021-04-04 cpcontacts.wemakelandingpages.com | 2021-04-04 mail.wemakelandingpages.com | 2021-04-04 webdisk.wemakelandingpages.com | 2021-04-04 webmail.wemakelandingpages.com | 2021-04-04 wemakelandingpages.com | 2017-04-07 www.wemakelandingpages.com | 2017-04-07

Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.

Related screenshots
Screenshots of pages that talked to this domain

DNS recordsRetrieved via DNS ANY query

A 34.174.224.225 (TTL: 21600)
MX mx30.antispam.mailspamprotection.com (Priority: 30)
MX mx10.antispam.mailspamprotection.com (Priority: 10)
MX mx20.antispam.mailspamprotection.com (Priority: 20)
NS ns2.siteground.net
NS ns1.siteground.net
TXT v=spf1 +a +mx include:wemakelandingpages.com.spf.auto.dnssmarthost.net ~all
SOA ns1.siteground.net
hostmaster: admins.siteground.com / serial: 7 / refresh: 10800 / retry: 3600 / expire: 604800 / minttl: 3600 /