rylieslandscapeanddesign.wemakelandingpages.com
Not observed on urlscan.io
General Info Open in Search
Created | November 29th, 2024 |
Domain | wemakelandingpages.com (The registered domain) |
No direct hits
Nothing is hosted on this domain
No incoming hits
Nothing talked to this domain
Disclaimer
The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.
Recently observed hostnames on 'rylieslandscapeanddesign.wemakelandingpages.com'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.
rylieslandscapeanddesign.wemakelandingpages.com
| 2021-04-04
www.rylieslandscapeanddesign.wemakelandingpages.com
| 2021-04-04
Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.
WHOIS for rylieslandscapeanddesign.wemakelandingpages.com
Domain Name: WEMAKELANDINGPAGES.COM Registry Domain ID: 2938188978_DOMAIN_COM-VRSN Registrar WHOIS Server: whois-service.virtualcloud.co Registrar URL: https://www.sav.com/ Updated Date: 2024-12-10T15:34:01Z Creation Date: 2024-11-29T16:00:14Z Registrar Registration Expiration Date: 2025-11-29T16:00:14Z Registrar: SAV.COM, LLC Registrar IANA ID: 609 Registrar Abuse Contact Email: ABUSE-CONTACT@SAV.COM Registrar Abuse Contact Phone: +1.8885808790 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Registry Registrant ID: Not Available From Registry Registrant Name: REDACTED FOR PRIVACY Registrant Organization: REDACTED FOR PRIVACY Registrant Street: 2229 S MICHIGAN AVE SUITE 303 Registrant City: CHICAGO Registrant State/Province: ILLINOIS Registrant Postal Code: 60616 Registrant Country: US Registrant Phone: +1.2563740797 Registrant Phone Ext: Registrant Fax: Registrant Fax Ext: Registrant Email: Select Contact Domain Holder Link https://privacy.sav.com/?domain=wemakelandingpages.com Registry Admin ID: Not Available From Registry Admin Name: REDACTED FOR PRIVACY Admin Organization: REDACTED FOR PRIVACY Admin Street: 2229 S MICHIGAN AVE SUITE 303 Admin City: CHICAGO Admin State/Province: ILLINOIS Admin Postal Code: 60616 Admin Country: US Admin Phone: +1.2563740797 Admin Phone Ext: Admin Fax: Admin Fax Ext: Admin Email: Select Contact Domain Holder Link https://privacy.sav.com/?domain=wemakelandingpages.com Registry Tech ID: Not Available From Registry Tech Name: REDACTED FOR PRIVACY Tech Organization: REDACTED FOR PRIVACY Tech Street: 2229 S MICHIGAN AVE SUITE 303 Tech City: CHICAGO Tech State/Province: ILLINOIS Tech Postal Code: 60616 Tech Country: US Tech Phone: +1.2563740797 Tech Phone Ext: Tech Fax: Tech Fax Ext: Tech Email: Select Contact Domain Holder Link https://privacy.sav.com/?domain=wemakelandingpages.com Name Server: NS1.SITEGROUND.NET Name Server: NS2.SITEGROUND.NET DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2024-12-10T15:34:01Z <<< For more information on Whois status codes, please visit https://icann.org/epp