kitchendesignideasminimalist.netlify.app
AMAZON-02, US


Not observed on urlscan.io


General Info Open in Search

Geo Frankfurt am Main, Germany (DE) —
AS AS16509 - AMAZON-02, US
Note: An IP might be announced by multiple ASs. This is not shown.
Route 3.120.0.0/13 (Route of ASN)
PTR ec2-3-124-100-143.eu-central-1.compute.amazonaws.com(PTR record of primary IP)
IPv4 3.124.100.143  3.125.36.175 
IPv6 2a05:d014:58f:6202::65 2a05:d014:58f:6201::65

Live Screenshot Hover to expand

Attention: This is a live snapshot of this website, we do not host or control it!

No direct hits
Nothing is hosted on this domain

No incoming hits
Nothing talked to this domain

Disclaimer

The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.

WHOIS for kitchendesignideasminimalist.netlify.app

Nameserver not found.
>>> Last update of WHOIS database: 2024-11-16T13:02:54Z <<<

Please query the WHOIS server of the owning registrar identified in this
output for information on how to contact the Registrant, Admin, or Tech
contact of the queried domain name.

You may also request underlying Registrant data via ICANN's RDRS service
(https://rdrs.icann.org/).

WHOIS information is provided by Charleston Road Registry Inc. (CRR) solely
for query-based, informational purposes. By querying our WHOIS database, you
are agreeing to comply with these terms
(https://www.registry.google/about/whois-disclaimer.html) and acknowledge
that your information will be used in accordance with CRR's Privacy Policy
(https://www.registry.google/about/privacy.html), so please read those
documents carefully.  Any information provided is "as is" without any
guarantee of accuracy. You may not use such information to (a) allow,
enable, or otherwise support the transmission of mass unsolicited,
commercial advertising or solicitations; (b) enable high volume, automated,
electronic processes that access the systems of CRR or any ICANN-Accredited
Registrar, except as reasonably necessary to register domain names or modify
existing registrations; or (c) engage in or support unlawful behavior. CRR
reserves the right to restrict or deny your access to the Whois database,
and may modify these terms at any time.