hardworktoday.online


Seen 9 times between September 18th, 2022 and December 5th, 2022.


General Info Open in Search

Live Screenshot Hover to expand

Attention: This is a live snapshot of this website, we do not host or control it!

No direct hits
Nothing is hosted on this domain

Incoming hits
Summary of pages that talked to this domain

ASNs AS43996 | 5x AS16509 | 2x AS47583 | 1x AS54113 | 1x

IPs 185.28.222.11 | 3x 5.57.16.220 | 2x 45.84.206.68 | 1x 65.9.66.109 | 1x 108.138.7.78 | 1x 2a04:4e42::285 | 1x

Domains www.booking.com | 7x booking.kayak.com | 1x preciousbanco.online | 1x

Countries NL | 5x US | 3x DE | 1x

Recent scans (9 total) Show all

URL Age
www.booking.com/index.de.html?label=gen173nr-1BCAEoggI46AdIM1gEaDuIAQGYAQe4AR... 2 years
www.booking.com/index.it.html 2 years
www.booking.com/index.it.html 2 years
www.booking.com/index.it.html 2 years
booking.kayak.com 2 years

Disclaimer

The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.

Recently observed hostnames on 'hardworktoday.online'
Searching for newly observed domains and hostnames is possible on our urlscan Pro platform.

trackbot.hardworktoday.online | 2023-03-31 trackbot2.hardworktoday.online | 2023-03-31 bottracksite.hardworktoday.online | 2023-03-31 www.arlosetupblog.hardworktoday.online | 2023-02-22 www.kiwii.hardworktoday.online | 2023-02-18 www.bookking.hardworktoday.online | 2023-02-18 www.trackier-one.hardworktoday.online | 2023-02-13 www.onetogo.hardworktoday.online | 2022-12-31 www.tb12.hardworktoday.online | 2022-12-06 www.tbo.hardworktoday.online | 2022-12-06 www.bottracker.hardworktoday.online | 2022-12-05 www.bot-tracker.hardworktoday.online | 2022-12-05 www.trackingbott.hardworktoday.online | 2022-12-05 www.trackbott.hardworktoday.online | 2022-12-05 www.track-bot.hardworktoday.online | 2022-12-05 www.trackbot2.hardworktoday.online | 2022-12-04 www.trackbot.hardworktoday.online | 2022-12-03 www.bottracksite.hardworktoday.online | 2022-12-03 www.bottrack.hardworktoday.online | 2022-12-02 www.readddyonee.hardworktoday.online | 2022-12-02 www.gobooking.hardworktoday.online | 2022-12-02 www.cricketbooks.hardworktoday.online | 2022-11-30 www.bottracking.hardworktoday.online | 2022-11-29 www.trackingbot.hardworktoday.online | 2022-11-23 www.trackinglive.hardworktoday.online | 2022-11-22 www.assignmentsassistance.hardworktoday.online | 2022-11-16 www.mahakaaalbook.hardworktoday.online | 2022-11-16 www.bestfareflix.hardworktoday.online | 2022-10-19 www.holidaybreakflix.hardworktoday.online | 2022-10-19 www.preciousrelo.hardworktoday.online | 2022-10-18 www.preciousrico.hardworktoday.online | 2022-10-18 www.acrepair-services.hardworktoday.online | 2022-10-04 digitalmytvrepairservices.hardworktoday.online | 2022-10-04 www.digitalmytvrepairservices.hardworktoday.online | 2022-10-04 www.preciousbanco.hardworktoday.online | 2022-09-18 hardworktoday.online | 2022-06-01 neocart.hardworktoday.online | 2022-05-31 www.neocart.hardworktoday.online | 2022-05-31 primemock.hardworktoday.online | 2022-05-30 www.primemock.hardworktoday.online | 2022-05-30 www.premiumcarfleet.hardworktoday.online | 2022-04-18 www.premiumcarglance.hardworktoday.online | 2022-04-18 www.primedock.hardworktoday.online | 2022-04-18 www.primedrift.hardworktoday.online | 2022-04-18 www.primetix.hardworktoday.online | 2022-04-18

Attention: These domains and hostnames were discovered through Certificate Transparency (CT) Logs and have been irrevocably published as part of the public record. There is no mechanism for us or anyone else to remove this information from the Internet.

Related screenshots
Screenshots of pages that talked to this domain

WHOIS for hardworktoday.online

The queried object does not exist: DOMAIN NOT FOUND

>>> Last update of WHOIS database: 2024-12-11T20:39:13.0Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

>>> IMPORTANT INFORMATION ABOUT THE DEPLOYMENT OF RDAP: please visit
https://www.centralnicregistry.com/support/rdap <<<

The Whois and RDAP services are provided by CentralNic, and contain
information pertaining to Internet domain names registered by our
our customers. By using this service you are agreeing (1) not to use any
information presented here for any purpose other than determining
ownership of domain names, (2) not to store or reproduce this data in
any way, (3) not to use any high-volume, automated, electronic processes
to obtain data from this service. Abuse of this service is monitored and
actions in contravention of these terms will result in being permanently
blacklisted. All data is (c) CentralNic Ltd (https://www.centralnicregistry.com)

Access to the Whois and RDAP services is rate limited. For more
information, visit https://registrar-console.centralnicregistry.com/pub/whois_guidance.