50-6-193-14.unifiedlayer.com
Seen 3 times between September 28th, 2024 and October 1st, 2024.
General Info Open in Search
Created | August 14th, 2012 |
Domain | unifiedlayer.com (The registered domain) |
No direct hits
Nothing is hosted on this domain
Incoming hits
Summary of pages that talked to this domain
ASNs AS16509 | 2x AS19871 | 1x
IPs 13.33.191.52 | 1x 50.6.193.14 | 1x 2600:9000:2057:d200:7:49a5:5fd4:b121 | 1x
Domains www.amazon.com | 2x supportwebappsrenewaccmangesverifyng.rhinobunseller.com | 1x
Countries US | 3x
Recent scans (3 total) Show all
URL | Age | |||||
---|---|---|---|---|---|---|
www.amazon.com/ap/signin | 5 days | 23 | 5 | 1 | ||
www.amazon.com/ap/signin | 6 days | 25 | 5 | 1 | ||
supportwebappsrenewaccmangesverifyng.rhinobunseller.com | 8 days | 2 | 1 | 1 |
Disclaimer
The websites, domains, and other information displayed on this page are not managed by urlscan. Each website and its contents are solely the responsibility of their respective owners. urlscan can remove specific website scans from our platform, but urlscan does not bear responsibility for their content. If you have been a victim of fraud by any of the websites listed, please contact your local law enforcement to report it.
WHOIS for 50-6-193-14.unifiedlayer.com
Domain Name: UNIFIEDLAYER.COM Registry Domain ID: 1738889745_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.domain.com Registrar URL: www.domain.com Updated Date: 2022-10-04T19:46:28 Creation Date: 2012-08-14T18:34:52 Registrar Registration Expiration Date: 2029-08-14T18:34:52 Registrar: Domain.com, LLC Registrar IANA ID: 886 Reseller: Domain Name Holding Company, Inc Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Registry Registrant ID: Registrant Name: Domain Manager Registrant Organization: Newfold Digital, Inc. Registrant Street: 5335 Gate Parkway Suite 300 Registrant City: Jacksonville Registrant State/Province: FL Registrant Postal Code: 32256 Registrant Country: US Registrant Phone: +1.9046806600 Registrant Phone Ext: Registrant Fax: Registrant Fax Ext: Registrant Email: corpdomains@newfold.com Registry Admin ID: Admin Name: REDACTED FOR PRIVACY Admin Organization: REDACTED FOR PRIVACY Admin Street: REDACTED FOR PRIVACY Admin City: REDACTED FOR PRIVACY Admin State/Province: REDACTED FOR PRIVACY Admin Postal Code: REDACTED FOR PRIVACY Admin Country: REDACTED FOR PRIVACY Admin Phone: REDACTED FOR PRIVACY Admin Phone Ext: Admin Fax: REDACTED FOR PRIVACY Admin Fax Ext: Admin Email: REDACTED FOR PRIVACY Registry Tech ID: Tech Name: REDACTED FOR PRIVACY Tech Organization: REDACTED FOR PRIVACY Tech Street: REDACTED FOR PRIVACY Tech City: REDACTED FOR PRIVACY Tech State/Province: REDACTED FOR PRIVACY Tech Postal Code: REDACTED FOR PRIVACY Tech Country: REDACTED FOR PRIVACY Tech Phone: REDACTED FOR PRIVACY Tech Phone Ext: Tech Fax: REDACTED FOR PRIVACY Tech Fax Ext: Tech Email: REDACTED FOR PRIVACY Name Server: ns1.unifiedlayer.com Name Server: ns2.unifiedlayer.com DNSSEC: unsigned Registrar Abuse Contact Email: compliance@domain-inc.net Registrar Abuse Contact Phone: +1.6027165396 URL of the ICANN WHOIS Data Problem Reporting System: https://icann.org/wicf >>> Last update of WHOIS database: 2024-10-06T14:26:56Z <<< "For more information on Whois status codes, please visit https://icann.org/epp" Registration Service Provider: Domain Name Holding Company, Inc, corpdomains@newfold.com +1.8007972958